SecReT6
Protein ID: 378953697
SecReT6 ID541
T6SS typei1
Gene symbolstp1
Locus tagPSF113_5816
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6708101..6708823 [-]
Productprotein Stp1
NoteStp1
UniProt IDG8Q734
KEGG IDpfe:PSF113_5816
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-17, Aligned region: 20..229
PP2C [PF00481], Evalue: 3.90E-15, Aligned region: 31..200
SpoIIE [PF07228], Evalue: 1.80E-09, Aligned region: 35..239
Protein Sequence: 240 a.a.     [Download]
>gi|378953697|ref|YP_005211185.1| protein Stp1 [Pseudomonas fluorescens F113]
MEAGPWYSAARTDPGKTRPRNEDAFLDCPQQGMWAVADGMGGHSGGDIASQLIVANLTELPLYRDLAERS
KAVRQCLRWTNRRLSQELTVTDDHPGIIGSTVVALLLEGNRGVCIWAGDSRCYLWRGRRLYQLTKDHSLQ
QQLIDTQRISRDEACAHPAAKALTRAVGAAPELTLEVLELDVHAGDTFLLCSDGLYQGLGAQALGSALDL
ASPRVALEHLFDDVLRGPARDNLTAVVVRP
 
Nucleotide Sequence: 723 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6708823-6708101 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGAGGCCGGCCCCTGGTACAGCGCCGCGCGCACGGACCCTGGCAAGACCCGGCCACGTAATGAGGATG
CTTTTCTCGATTGCCCACAACAGGGGATGTGGGCGGTGGCCGACGGCATGGGTGGCCACTCGGGGGGTGA
CATTGCCAGCCAGCTGATCGTTGCCAACTTGACGGAGCTGCCGCTGTACCGGGACTTGGCTGAGCGTTCG
AAAGCGGTGCGCCAATGCCTGCGCTGGACCAACCGACGACTGAGCCAGGAGCTTACCGTCACCGACGATC
ATCCCGGCATTATCGGCAGCACCGTGGTGGCGCTGTTGTTGGAAGGAAACCGTGGAGTCTGCATCTGGGC
GGGCGACAGCCGTTGTTATCTGTGGCGGGGTCGGCGACTGTACCAACTGACCAAGGACCACTCACTGCAA
CAGCAACTGATCGACACGCAACGCATCAGTCGCGATGAGGCCTGTGCCCATCCTGCGGCCAAGGCACTGA
CCCGCGCGGTCGGTGCCGCCCCAGAGTTGACGCTGGAGGTGTTGGAGCTGGATGTTCACGCGGGCGATAC
GTTCTTGCTGTGCAGTGACGGCCTGTACCAAGGCCTTGGCGCGCAAGCCCTTGGCAGTGCCTTGGACCTG
GCTTCGCCGCGCGTGGCGTTGGAACATCTTTTCGACGACGTTCTACGTGGCCCGGCACGGGATAACCTGA
CGGCCGTGGTGGTCCGCCCGTGA
 Primer design