SecReT6
Protein ID: 378953698
SecReT6 ID541
T6SS typei1
Gene symbolicmF2
Locus tagPSF113_5817
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6708823..6712266 [-]
Productprotein IcmF2
NoteTssM
UniProt IDG8Q735
KEGG IDpfe:PSF113_5817
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.60E-71, Aligned region: 480..768
ImcF-related_N [PF14331], Evalue: 1.60E-61, Aligned region: 195..382
ImcF-related_N [PF14331], Evalue: 1.60E-61, Aligned region: 383..428
DUF1215 [PF06744], Evalue: 3.20E-36, Aligned region: 883..1006
Protein Sequence: 1147 a.a.     [Download]
>gi|378953698|ref|YP_005211186.1| protein IcmF2 [Pseudomonas fluorescens F113]
MKLLFRKAGAWVRQTWIWTLLAVLCIALLVWFAGPLLAVNDYKFWASPTARLLTVSVLMLCWGLAMVFVN
GRGGSSANFQQNAPEQARALHQARIDDERREVRSRFKQALSTLRSSSLYPGRSERWRNDLPWYLLIGPPA
SGKTRLLDCSGLEFPLDKLERKPIGDTSGTRYCDWYFAEHAVLVDTAGRYLTQTDSDVDSSAWTVLLELL
RKRRRSRPLSGVLVTVPTEVLLLGSEDEVTTLARQIRGRLQELQQRLHVDVPVYLVLSKADGVPGFNEFF
DSLTREENDQVLGASFSRDQRGSDVAVLRAEFEALLHRLNSQVIMRMHQERDPLRRSCMLDFPHQLGQLG
AGLCLLVEQAFTGNVGTLRGFYLTSASPPGRTNTAPDRRSRFINHLVSRVIFPEADLTDLVQRERRRLHW
GQRALYLGALTVVGLCGLLWANGFSANHERLDNLRTLAQRWDQQQSSQANADDWVAILDSLDIRFEATRV
FPPDRAVPLHERVGLYQGDASNPAVTDAYERELQARLLPKVAQRLEAHVRNNWNDREQLLNSLRAYLMLG
LQERRDVAWLKVWLANDGSLRHPGNTALQEGLNAHLERLLELPFIHALNEPLVAQAREALRRESLAVVVY
RMLHEQASHLPQYRFSQHLGSQGALLVGTDRMIPGFYTRQGYERYFSVQGTALVTELLRDNWVLGEGEGL
SGMDMRRLMVELEQLYFRDYADHWSEAVGQVALQTISNAGEGAEQLAGLTSAHSPILRMLVQVREHTRIQ
AVAEQIDDLTQAAGNGGHAVTTLAAVAGKASASLAENLPDTAQKSLRRRFEPLHRLLDPDNAPTADLVQA
LRAIDEVQLQLANLARASAPEQAAFELARHRMGGQRDALSHLRGASARLPRPVSAWFNVMAEDSWRLVLN
DSYRYLNQRYQSELYSFYGKAINKRYPFSAHSASDVALNDFREFFKDQGIVDRFFDNYMQPFVSGSAGHY
RLRSIDGQSLPMSRVYLDQMATAHTIRRSFFAENPTEPQVQFKLEPYTLDPAVSRAEFRFGDQMLEYRHG
PILPVAFTWPSDAQNGRTALVLDKMVGRGVGIEKNTGAWSLFRLFDLMQSEYLTGRDVRVLKADLGGLRA
NYLLTSQRTPNPFDMSVLRTFRLPVQL
 
Nucleotide Sequence: 3444 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6712266-6708823 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAAATTGCTTTTCAGGAAAGCCGGTGCCTGGGTGCGCCAGACGTGGATTTGGACGCTGCTGGCGGTGC
TTTGTATCGCGTTGCTGGTGTGGTTCGCCGGGCCACTTCTGGCCGTCAATGACTACAAATTCTGGGCAAG
CCCGACAGCGCGGTTGCTGACCGTCAGCGTGTTAATGCTGTGCTGGGGCTTGGCCATGGTTTTCGTCAAT
GGGCGCGGTGGTTCAAGCGCGAATTTCCAGCAAAACGCCCCCGAGCAGGCTCGGGCCCTGCATCAGGCCA
GGATTGATGATGAGCGGCGCGAAGTGCGCTCGCGCTTCAAGCAGGCATTATCCACGCTAAGGTCCTCGAG
CCTTTATCCCGGCCGCAGCGAACGCTGGCGCAACGATCTGCCGTGGTATCTGCTGATCGGCCCGCCTGCC
AGCGGCAAGACCCGTCTGCTGGACTGCTCGGGCCTGGAGTTCCCTCTCGACAAGCTTGAGCGCAAGCCAA
TCGGCGACACGTCGGGTACCCGTTATTGCGATTGGTATTTTGCCGAGCACGCCGTGCTGGTCGACACTGC
CGGGCGCTACCTGACCCAGACGGACAGTGATGTCGACAGCAGTGCCTGGACCGTATTGCTCGAACTGCTG
CGCAAGCGTCGCCGCAGTCGTCCGTTGAGCGGTGTACTGGTGACGGTACCGACCGAGGTCCTGTTGCTGG
GCAGCGAGGACGAAGTGACTACGCTGGCCCGCCAGATTCGTGGCCGCCTGCAGGAACTGCAACAGCGACT
GCACGTCGATGTCCCGGTTTATCTGGTCCTGAGCAAAGCGGACGGCGTGCCAGGTTTCAATGAGTTCTTT
GATTCGTTGACTCGCGAAGAAAACGACCAGGTATTGGGTGCAAGTTTCAGTCGGGACCAGCGTGGCAGTG
ATGTGGCCGTGTTACGTGCCGAGTTCGAGGCGCTGCTGCATCGCCTCAACAGCCAGGTGATCATGCGGAT
GCATCAGGAGCGCGACCCGCTGCGCCGTAGCTGCATGCTTGATTTCCCTCACCAACTTGGACAACTCGGT
GCCGGCCTGTGTCTGCTGGTCGAGCAGGCGTTTACCGGTAACGTTGGTACGTTGCGTGGTTTCTATTTGA
CTAGCGCATCGCCGCCGGGCCGAACCAACACCGCGCCTGACCGGCGCTCGCGGTTCATCAATCACTTGGT
CAGCCGGGTGATTTTCCCGGAAGCCGATCTGACTGATCTCGTTCAGCGCGAGCGCCGTCGTCTCCATTGG
GGACAGCGGGCCTTGTACCTCGGGGCGTTGACGGTCGTTGGCTTGTGCGGGTTGTTGTGGGCGAATGGTT
TTTCGGCCAACCACGAGCGCCTGGACAACTTGCGGACACTGGCGCAGCGCTGGGACCAGCAGCAATCATC
CCAGGCTAACGCCGATGATTGGGTTGCAATACTCGACTCACTGGATATCCGTTTCGAGGCCACCCGGGTT
TTCCCGCCCGACAGGGCGGTGCCTTTACATGAGCGCGTCGGTCTGTACCAGGGCGATGCGAGCAACCCTG
CGGTGACCGACGCCTACGAGCGTGAATTACAGGCGCGACTGTTGCCGAAGGTTGCGCAGAGGCTGGAAGC
GCATGTCCGTAACAACTGGAATGACCGCGAGCAACTGCTCAACAGCCTGCGTGCGTACTTGATGCTGGGC
CTGCAAGAGCGCCGCGATGTTGCCTGGCTCAAGGTTTGGCTGGCCAACGATGGGTCGCTTCGTCACCCCG
GCAACACGGCACTACAGGAGGGCCTGAATGCCCACCTCGAGCGCCTGTTGGAGCTACCGTTTATCCATGC
GCTCAACGAACCGCTGGTGGCCCAGGCCCGGGAAGCCTTGCGCCGTGAGTCCCTGGCAGTCGTCGTGTAC
AGAATGCTGCACGAACAGGCCAGCCATCTGCCGCAATACCGATTCAGCCAACACCTGGGCTCGCAAGGTG
CGTTGTTGGTCGGTACCGATCGTATGATTCCCGGTTTCTATACCCGCCAGGGTTACGAACGCTACTTTTC
GGTTCAAGGCACGGCCCTGGTCACCGAGTTGCTGCGGGACAACTGGGTATTGGGTGAAGGCGAGGGCCTC
AGCGGCATGGACATGCGTCGCCTGATGGTCGAACTGGAACAGCTGTATTTTCGTGACTATGCCGACCACT
GGAGCGAAGCGGTCGGCCAGGTCGCCCTACAAACCATCAGCAATGCAGGTGAGGGCGCCGAGCAACTCGC
GGGGCTGACCTCGGCTCACTCGCCGATTCTGCGGATGCTGGTGCAAGTGCGCGAACACACTCGAATCCAG
GCTGTTGCCGAGCAAATCGACGACCTGACGCAAGCGGCAGGGAACGGTGGACATGCCGTTACAACACTCG
CCGCCGTGGCTGGGAAAGCCTCTGCGTCCTTGGCCGAAAACCTGCCGGACACCGCGCAAAAATCCTTGCG
ACGACGTTTCGAGCCGCTGCATCGCCTGCTGGACCCGGACAATGCTCCGACGGCAGATCTGGTCCAGGCC
TTGCGGGCCATTGATGAGGTGCAATTGCAACTGGCGAACCTGGCTCGCGCCAGTGCCCCGGAACAAGCGG
CGTTCGAGCTGGCCAGGCACCGCATGGGCGGCCAGCGCGATGCGTTGAGTCACCTGCGCGGTGCGTCTGC
CCGCCTGCCGCGGCCGGTCAGTGCTTGGTTCAACGTGATGGCTGAGGACAGCTGGCGCTTGGTGCTCAAT
GATTCTTATCGTTACCTGAACCAACGTTATCAGAGCGAGCTGTACAGCTTTTACGGCAAGGCGATCAACA
AGCGATACCCGTTCAGTGCCCACAGTGCCAGCGACGTCGCGCTCAATGACTTCCGGGAGTTCTTCAAGGA
CCAGGGTATCGTCGATCGATTCTTCGACAATTACATGCAGCCCTTCGTCAGCGGCTCCGCGGGACACTAC
CGCCTGCGCAGCATCGACGGTCAGAGCTTGCCGATGTCCCGGGTCTATCTCGATCAAATGGCAACCGCGC
ACACCATTCGCCGGAGCTTTTTCGCCGAAAACCCGACCGAACCGCAAGTACAGTTCAAGCTTGAGCCGTA
CACCCTGGACCCTGCGGTAAGCCGTGCTGAATTCCGTTTCGGTGACCAGATGCTTGAATACCGCCACGGT
CCGATCCTGCCGGTGGCGTTTACCTGGCCAAGCGACGCGCAGAATGGTCGAACCGCCCTGGTGCTGGACA
AAATGGTTGGGCGAGGCGTGGGCATCGAGAAAAATACCGGGGCGTGGTCGCTGTTTCGGTTGTTCGACCT
GATGCAGAGCGAATACCTGACCGGGCGCGATGTCCGCGTATTGAAGGCAGACCTGGGTGGCCTGCGCGCC
AACTATCTGCTGACGAGCCAACGTACGCCGAACCCTTTCGACATGAGTGTGCTGCGCACATTTCGCCTGC
CGGTGCAGCTTTGA
 Primer design