SecReT6
Protein ID: 378953703
SecReT6 ID541
T6SS typei1
Gene symbolsfa2
Locus tagPSF113_5822
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6716055..6717572 [-]
Productprotein Sfa2
NoteSfa2
UniProt IDG8Q740
KEGG IDpfe:PSF113_5822
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 6.20E-70, Aligned region: 196..362
Sigma54_activ_2 [PF14532], Evalue: 4.20E-24, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 2.10E-11, Aligned region: 353..360
HTH_8 [PF02954], Evalue: 2.10E-11, Aligned region: 456..496
AAA_5 [PF07728], Evalue: 8.80E-07, Aligned region: 220..339
HTH_30 [PF13556], Evalue: 0.0012, Aligned region: 451..465
HTH_30 [PF13556], Evalue: 0.0012, Aligned region: 470..496
GAF_3 [PF13492], Evalue: 0.0017, Aligned region: 29..148
GAF_3 [PF13492], Evalue: 0.0017, Aligned region: 203..243
GAF_2 [PF13185], Evalue: 0.003, Aligned region: 37..145
GAF_2 [PF13185], Evalue: 0.003, Aligned region: 245..257
Protein Sequence: 505 a.a.     [Download]
>gi|378953703|ref|YP_005211191.1| protein Sfa2 [Pseudomonas fluorescens F113]
MFKKLSQPLDYAEALLAQFSDLSRLADGAELVGKFIQGVARLSGCELVQLYLLDATRTRLEMNTECLEGQ
LQFRDPKSLPSDYHSEQLLQFSLCQNRVVCLDALSDSVHETGFLPPRARPWQSLLCVPLGDPQDGVAGLL
LCASNQHLDLHGIAESLGHLGTFALGQMHLLQRLRGPVDESEPDTTSLPSAVSYGLIGKSMAMRKTCSLL
SKVLHSPYTVLLRGETGTGKEVVARVLHDYGPRRSKAFIVQNCAAVPENLLESELFGYRKGAFTGADRDR
AGLFDAANGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGSNVTHHVDVRIIAATHRDLKQLMEEGKFR
EDLYYRLAQFPIPLPALRQRDGDIIELARHFADKACTLLQRDPVRWSDAALDHLAAYDFPGNVRELKSIV
ERAVLLCEGGELLVEHFALHIQTPAERGRVSLRERMEQIERGLLIDGLRESSGNKARAARELGLPLRTLV
YRLARLNVQRSDFKD
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6717572-6716055 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTTCAAGAAACTCTCGCAACCGTTGGACTATGCCGAAGCGCTTCTGGCGCAGTTTTCCGACCTTTCAC
GTTTGGCGGACGGTGCTGAGCTGGTGGGGAAGTTCATCCAGGGCGTAGCGCGGCTCAGTGGCTGTGAACT
GGTGCAGTTGTACCTGCTCGATGCCACTCGCACCCGCCTGGAAATGAACACCGAGTGCCTGGAAGGGCAG
TTGCAATTTCGTGACCCGAAAAGCCTGCCCTCCGACTACCACTCCGAGCAATTGTTGCAATTTTCCCTGT
GCCAGAACCGTGTGGTGTGCCTCGACGCGTTAAGCGACAGCGTGCACGAAACCGGTTTCCTGCCGCCGCG
GGCCAGACCCTGGCAGTCGCTGCTTTGCGTTCCCCTGGGCGATCCGCAGGATGGGGTCGCAGGCTTGTTG
CTATGCGCGAGCAATCAGCACCTCGACCTGCATGGTATCGCTGAGTCCCTGGGGCATCTTGGGACCTTCG
CGCTTGGTCAGATGCATCTGTTACAGCGCCTGCGCGGTCCTGTTGATGAGTCAGAGCCTGATACCACAAG
CCTGCCGAGCGCCGTCAGTTACGGCCTGATTGGCAAGAGCATGGCCATGCGCAAGACCTGCTCATTGCTC
AGTAAAGTACTGCACAGCCCCTATACCGTCCTGCTGCGGGGTGAGACCGGTACCGGCAAGGAGGTGGTGG
CCCGGGTCCTCCATGATTACGGCCCGCGTCGATCCAAGGCGTTTATCGTGCAGAACTGTGCGGCGGTTCC
CGAGAACTTGTTGGAGAGTGAGCTTTTCGGCTATCGCAAGGGCGCGTTCACCGGTGCCGACCGGGACCGG
GCCGGGCTGTTCGACGCGGCCAACGGCGGCACGCTGTTGCTCGATGAAATCGGCGATATGCCGTTATCCC
TGCAGGCCAAGTTGTTGCGAGTGTTGCAGGAAGGCGAAATCCGGCCGTTGGGGTCCAACGTCACTCACCA
TGTCGACGTGCGCATCATAGCCGCCACCCACCGCGACCTGAAGCAACTGATGGAGGAGGGCAAGTTCCGC
GAAGACCTGTATTACCGCCTTGCGCAGTTTCCAATTCCGCTACCGGCGTTGCGCCAGCGCGACGGCGACA
TCATTGAGCTGGCGCGGCATTTTGCCGACAAGGCTTGCACACTCCTGCAGCGTGATCCGGTGCGCTGGTC
AGACGCAGCGCTCGATCACCTGGCTGCCTACGACTTCCCGGGAAACGTCCGTGAACTCAAGAGCATCGTA
GAAAGGGCCGTGCTCTTGTGCGAGGGCGGCGAACTGCTTGTCGAGCATTTTGCACTACACATCCAGACCC
CAGCCGAGCGGGGCCGTGTGAGCTTGCGTGAACGGATGGAGCAGATCGAACGTGGCCTGCTGATCGATGG
CCTGCGCGAGAGTTCGGGCAACAAGGCGCGTGCCGCCCGTGAACTTGGCTTGCCGCTACGCACGCTGGTC
TATCGCCTTGCGCGCCTGAACGTTCAGCGTAGTGATTTCAAAGATTGA
 Primer design