SecReT6
Protein ID: 378979409
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32500
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3240404..3243814 [-]
Producthypothetical protein
NoteTssM
UniProt IDG8VW41
KEGG IDkpm:KPHS_32500
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.90E-77, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 3.10E-34, Aligned region: 632..681
DUF1215 [PF06744], Evalue: 3.10E-34, Aligned region: 855..973
Protein Sequence: 1136 a.a.     [Download]
>gi|378979409|ref|YP_005227550.1| hypothetical protein KPHS_32500 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MNIPGNGLGRFGLAGLTLAGMAAIWWGITRYGGMLNINTRGEQVLAFVQVCMALVFVFYLPAMSRRVKES
LYRRQSQQDSVLPGEEGRVALTPPHHITVGEIRQTLRYQYGRAWSRKVRILLIIGSVRDVEQLTPKLTQE
LWQEDQGTLLLWGGDPGAAVDNAWFTALRKLRYRPADGMVWVTSGFDGVLTTMNRTKPRLTPDEMDSVSH
SLKLRFEALGWKLPLYVWSLYEGGNEKNGRITQPVGCLLPAGCTPQIVAEQFTALASLLIEQGIQQICGQ
PQHNFLLALADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSEASVEAGRSVRHHWGRDNRWETIPDSVL
WLPAGLRPRKQGVNWMRGMSVAAAALMLLWAASMTVSFISNRHLVAIAQQQVQQASAGKQPLAVRLYALS
ALQKTLSQLEYRSQHGAPWYLRAGLSQNDDLLAALFPRYGEMAQPLLRDAAAHHLEEQLTAFVQLPPDSP
LREKMTKTAYGQLKQYLMLTRPEKMDAAWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLASHPQW
RLPVDDGLVSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFT
RQAWEQAVQPAIEKVVAERRDEMDWVLSDTKQTAAQSTSPEALRARLAERYFADFSGAWLDFLNSLRWQR
AATLSDAIDQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVKSARQLFNRDNPPVIDQRSGARG
PLDATFGPVLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLT
ETRDYGSLVAAGLGQEWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTS
SEVSLPLLAKYLNSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFA
NGEAGLHFALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWVSTRAGTRQYGDF
PGAWGWIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRAS
AERVPLTDDIPGEEGY
 
Nucleotide Sequence: 3411 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3243814-3240404 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAATATACCGGGTAATGGCCTGGGCCGGTTTGGCCTGGCCGGGCTTACGTTGGCCGGGATGGCTGCAA
TATGGTGGGGGATCACCCGCTATGGCGGCATGCTGAATATCAATACGCGGGGCGAGCAGGTACTGGCGTT
TGTCCAGGTCTGTATGGCGTTGGTATTTGTTTTTTACCTTCCTGCAATGTCCCGCCGTGTGAAGGAGAGT
TTATATCGCCGGCAGTCGCAGCAGGACAGCGTCTTACCCGGCGAAGAAGGGCGCGTGGCGCTGACACCTC
CCCATCATATTACGGTGGGGGAAATTCGCCAGACTCTACGCTATCAGTATGGACGCGCCTGGTCCCGCAA
AGTCCGTATTCTGCTGATAATTGGCTCAGTCAGAGACGTAGAACAACTGACCCCAAAGCTCACGCAGGAA
CTCTGGCAGGAAGATCAGGGTACATTATTGCTGTGGGGTGGAGACCCTGGGGCAGCGGTAGATAACGCCT
GGTTCACAGCGCTGCGTAAACTGCGTTATCGCCCGGCTGATGGTATGGTGTGGGTAACATCGGGCTTTGA
CGGCGTTTTGACAACGATGAACAGAACGAAGCCCAGGCTCACGCCAGATGAAATGGACAGTGTGTCTCAC
TCTCTAAAGCTACGCTTCGAAGCTCTTGGCTGGAAACTACCCCTATACGTCTGGTCGCTGTATGAGGGGG
GCAACGAAAAAAATGGACGTATCACTCAGCCTGTAGGCTGCCTGTTACCTGCAGGTTGTACGCCGCAAAT
AGTTGCCGAACAGTTCACTGCCCTGGCGTCGTTACTGATAGAGCAGGGCATCCAGCAGATATGCGGGCAA
CCACAGCACAATTTTTTACTCGCGCTGGCCGATCAGTTGACCCGTAAACCGGAAACGGTGACGGAGCCGT
TATCGGTATTGCTTAATCCTTACCGCCCGCAGCCGCTGGCCGGGGTGGTATTTAGTGAGGCGTCAGTAGA
GGCTGGTCGCAGTGTCCGTCATCACTGGGGACGGGATAACCGCTGGGAAACGATACCAGACTCAGTGCTG
TGGTTGCCAGCCGGTCTACGTCCGCGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGGCCGCCG
CCGCCCTGATGTTACTCTGGGCCGCCTCAATGACAGTCTCTTTTATCTCCAACCGCCACCTGGTGGCGAT
CGCACAGCAGCAGGTGCAGCAGGCCTCGGCGGGAAAACAGCCGCTGGCCGTACGCCTGTATGCGCTCTCC
GCGTTACAGAAAACGCTTTCTCAACTGGAATACCGCTCGCAGCACGGAGCGCCGTGGTACCTCCGCGCTG
GCCTCAGTCAGAACGATGACCTGCTGGCGGCGCTGTTCCCGCGCTACGGGGAGATGGCGCAACCGCTGCT
GCGCGATGCGGCGGCGCATCATCTGGAAGAGCAGCTCACCGCCTTCGTGCAGCTGCCGCCGGACAGCCCA
CTGCGTGAGAAGATGACGAAGACCGCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCCCGGAAA
AAATGGACGCCGCGTGGTTCGCCACTACGCTAATGCAGGACTGGCCGCAGCGCTCAGGCATCGCCGACGC
CGTCTGGCAGGGCAGCGGCCCTTCGCTGCTGGCATTTTATGCCGCCAGCCTGGCATCGCATCCGCAGTGG
CGTCTGCCTGTCGATGACGGTCTGGTCAGCCAGGTGCGCACACGGTTAATTCGCCAACTGGGCCAGCGCA
ACAGTGAGTCCACGCTTTACCAGAAGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGC
GGATATGACTGCCGACACCGATGCTTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGAATGTTTACC
CGTCAGGCCTGGGAGCAGGCCGTGCAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGG
ACTGGGTGCTGAGCGATACGAAGCAGACTGCCGCGCAGTCGACGTCGCCGGAAGCTCTGCGAGCCAGGCT
GGCGGAGCGTTATTTCGCTGATTTCAGCGGCGCCTGGCTGGATTTCCTCAACAGTCTGCGCTGGCAGCGC
GCGGCGACCCTCTCCGATGCTATCGACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGG
CGCTGATGAACACCCTGAGCGTGCAGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGT
CAAATCGGCCAGGCAGCTGTTCAACCGTGACAACCCGCCCGTCATCGATCAACGGTCCGGCGCGCGCGGT
CCTCTGGATGCCACCTTCGGCCCCGTACTGGCGCTGCTGGACAATCGCGACGGCGGGACCCCCACCAGCC
GTCTTAGCCTGCAGACCTTCCTGACCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGC
CACCGATCCGCAGGCGATGACCCGCCTGCTTGCGCAGACGGTATTCCAGGGCAAGGCCGTGGATTTAACC
GAAACGCGCGACTACGGCAGCCTGGTGGCGGCGGGGCTGGGCCAGGAGTGGAGTGGATTTGGGCAAACGC
TGTTTGTTCGCCCGATGGAACAGGCCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGTCTCAACGCCCA
GTGGCGCAGCGCGGTGGTGGAGGACTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAATACCAGC
AGTGAAGTCTCTCTGCCGCTGCTGGCAAAATACCTCAACAGCGAGACCGGGCGCATCGCCCGCTTTCTGC
AGACCCGGCTGAACGGCGTACTGCATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGCCCAGGG
GCTGACGTTTAACCCGGCCTTTCTGCAGGCGATGAATACCCTGAGTCATCTCTCTGACGTCGCGTTCGCC
AACGGCGAAGCGGGATTGCATTTTGCGCTACGTCCCGGCACCGCGGACGGCGTGATGCAGACGGAGCTGG
TCATCGACAGTCAGAAACTTGTCTATATGAACCAGATGCCGGTCTGGCGGCGGTTCAGCTGGCCCGCTGA
CACCGAAGCGCCGGGCGCCAGTCTGAGCTGGGTCAGTACCCGGGCGGGCACCCGCCAGTATGGCGATTTC
CCGGGCGCCTGGGGGTGGATCCGTCTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGAGCAGCA
GCTGGAGCCTGAGCTGGAAAGCGCCGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGCGGGGGA
AGGACCGCTGGCGCTGCTGGCGCTGCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGCGCGTCT
GCTGAACGTGTTCCGCTGACCGACGATATACCCGGCGAAGAGGGATACTGA
 Primer design