SecReT6
Protein ID: 378987684
SecReT6 ID554
T6SS typei3
Gene symbol-
Locus tagSTMUK_0288
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. UK-1
Repliconchromosome [GenBank: NC_016863] [Browse all T6SS(s) in this replicon]
Location [Strand]323835..327704 [+]
Productputative inner membrane protein
NoteTssM
UniProt IDF5ZM64
KEGG IDsej:STMUK_0288
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.50E-93, Aligned region: 588..916
ImcF-related_N [PF14331], Evalue: 2.90E-92, Aligned region: 263..541
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 446..482
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 1025..1146
Protein Sequence: 1289 a.a.     [Download]
>gi|378987684|ref|YP_005250848.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGL
QFPLAEQMEQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRK
HRPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRT
LTSHLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASL
PHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDY
LNEISARATRLDGDVKAYTGKPAMAPVPALLDSARELSAWPELDPDAPPLAWRYGLYSVPPVTDSVASLY
NRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDS
VAGFGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLV
RAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAV
VEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQ
SGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKI
NAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDP
WRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAH
GPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3870 bp     [Download]
>gi|378987404|ref|NC_016863.1|:323835-327704 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 chromosome, complete genome
ATGCAAAAATTTCTTAGTCTGCTTTTTTCCCGGCGCGCGCTGGCAGTTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCGCTGGTGTCATTTGATACCCTGCGCCCGCTGGCCTCCGTGGGTAGCCG
GGTAGTGACCATTGCCCTGTTGCTGATGCTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCCTGGGCGATGTCCATCCGT
TTGCGCCGCTGTGGGTCCGCCTGACCCTGATTGGTTTCATCCTGCTGATGTACGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCAGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AGCTGCGGCAGTTGCGGGTGGATATGCCTGGCTGGCGTAAAATCTTCGAGGGAAAACGCTTTCTGTATGA
GCTGCCGTGGTTCATGGTGGTCGGCAGTCCCGGCGACGGCAAAACCACGGCCCTGCTGAACACCGGATTG
CAGTTCCCGCTGGCGGAGCAAATGGAGCAGACTTCGCGCATCCTGACAGTACCGGGTGGCGGCACGCTAC
ACTGCGACTGGTGGTTTACCAACGAAGCGGTGTTGATTGATACCGCCGGACGCTACGCCCGCCACGATGA
CGGTGGTGAAGCGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGCTTTCTCGGTCTGCTGCGTAAA
CATCGCCCCGGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCAC
CGGCGGAACGCCTGGCGGCCTGCGCCGCTCTGCGGGCGCGACTGGCAGAACTGCGCGAGACCCTGGGGAT
TCGCTTTCCGGTCTATCTGGTGGTCACCAAAATGGATTTGTTGCCGGGGTTCAGCGAATATTTTCGCACG
CTGACCAGCCATCTTCGTGCACAAATCTGGGGCTTCACGTTGCCGTACAGCCGCAGGCGAAAAGCGGGCG
ACCCGCAGGCGCTGCACGCCGCCTGCGCGCAGGAGCTGGCGCGCCTGACGCTGCGGTTGGATCAGGGACT
GGATACCCGGTTACAGGAAGAGTACGACCTTAAAAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTC
GCCGCCCTCGGCGAGCCGTTGCTGGAGGCTATTGAACAGATCTTCCTCGATTCAAAATTCGATGCCACGC
AACTGAATAACACGCTGCGCGGGGTGTTTTTCACCAGCGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGA
CCAGTTGAGTATCTGGCAGCGCTTTGTCCGGGCGATAAAAACCGCCCGTGGCGAATCCTCCGCCTCTCTC
CCACACGCTCTGCCGGACGGCAACCGCAGCTACTTCCTGCATGACCTGCTGACACAGTTTATTTTTCGTG
AAGCGCACCTGGTGGAGCCAAACCTCCAGTGGGCCTGGCGTTACCGCCTGCTGCGCCTCGGCGGGCACCT
GCTGGTACTGGTGCTGGCATTCCTGTTGTGGCAGGGGATGCAGACCAGCCAGCAGACCAACGGCGACTAT
CTGAATGAAATCAGCGCCCGCGCGACCCGGCTGGACGGTGATGTGAAAGCCTACACCGGTAAACCGGCGA
TGGCTCCCGTCCCGGCACTGCTGGACAGCGCAAGGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGC
GCCGCCGCTGGCCTGGCGCTACGGTCTGTACAGCGTACCGCCGGTAACCGACAGCGTGGCGTCGCTGTAC
AACCGTCTGCTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATGTGCTGGCGGACGCCA
TTGCCCGTCAGGATAGTAAAGCGGCCTACGATGCCCTGCGCATCTATCTGCTACTGAATCTGGATAAAGA
TCACGAAGATAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGC
GTGGCCGGGTTCGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGG
TGCATTCACCGTATGAGAAAGATGAGGCGCTGATCCGCCAGGCGCGGGCATTCCTCGACGGTCACACCAG
TACCGAGCGTATCTACGCGCGGGCGCTGGCGGCAATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTA
CGCGCCGTCGGCGCGGATGCGGGAACGGTCTTTGTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGC
CGGGTATTTTTACCCGTGAAGGATACCGGGAGCTGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGC
GACGGCGAACGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGC
CAGATACCGGGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACGGAATATGCCCGCC
GCTGGCAGGATTTTCTGGACAGTATCCATAGTATCAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGC
CTATGATTTACAGGTGCTGCGCACCCTGGCGTCGCCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTG
GTGGAGCAGACCACGCTGGTGCCGCCGCCGGACCCGCAGGCCAGACAGAAACAACTGGCGCAGCGCGCAT
CCGGTAACGCGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGA
AAAAACGCTGGTGGATGATCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAG
AGCGGCGGTGGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCCAACTGACCA
TTGCTGATAGCGCGCTGGCGGCGGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGA
GGCGGCGAAACTGCCCGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATC
AACGCCGGGACCGGCGACGTGCTGAACACCCAGATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCA
TCGACGGGCGCTATCCGTTCGCCGACAGTCCGCAGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGC
CAGCGGCGGCGTACTGGATGCTTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCG
TGGCGCTACAAACCGACCGAAGGCAACATGACATTGCAGGGGCCGGATCTGACGCCGTTTCAGCAGGCGA
AGCAGATCCGCAGCGTATTTTTTAACAGCGAGGGCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGT
GGTGGATATGGACCCGGCCATCACGGAACTGGTGATTGATATCGACGGCCAGGTGCTGCGCTACGCCCAT
GGTCCGGACCGTCCCCTGAAAGTAACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCA
GCCCGCGTATTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGA
CGCCGGAATGGTACAGGAAACGGCGGTGCGGGGGCGTCAACTGGTGGAATATGATTTTGACGGTCGCCGG
GTGGTGCTGGAAATCACCGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTT
GCCCGGCGAGGGCGCTGTAA
 Primer design