SecReT6
Protein ID: 379699481
SecReT6 ID552
T6SS typei3
Gene symbol-
Locus tagSTM474_0277
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]304656..305711 [-]
Productputative cytoplasmic protein
NoteTssA
UniProt IDE8XIT0
KEGG IDseb:STM474_0277
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 224..241
Protein Sequence: 351 a.a.     [Download]
>gi|379699481|ref|YP_005241209.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDASLARSNALAALLDHEG
VMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQ
VWARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGI
SLPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDAL
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|379699217|ref|NC_016857.1|:c305711-304656 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGTCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGC
GTGATGGCGGACATTCGCGGTATTACGCTGTCAAACAGTGCCGCCCTGCGCCTACAGGTACGGGATGTGG
AGCGCGCGTTATCCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGA
CCTCGAAGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAA
GTGTGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGC
TGCCTGACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGG
CACGGTTATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATA
TCCCTCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCA
TTCGTCGCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACT
GGTGGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTG
GAGTGA
 Primer design