SecReT6
Protein ID: 379699482
SecReT6 ID552
T6SS typei3
Gene symbol-
Locus tagSTM474_0278
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]305722..306717 [-]
Productputative cytoplasmic protein
NoteTssG
UniProt IDE8XIT1
KEGG IDseb:STM474_0278
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-94, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|379699482|ref|YP_005241210.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHD
RFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYC
WEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|379699217|ref|NC_016857.1|:c306717-305722 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
ATGACCGGCGCTCTCAACCAGGCGCAGAAAACCCCCTGGCGTTACGGATTCCTGAACCTGATGCGGCGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCAC
TGAACCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACCACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCTGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCAGCCTCCGCCCATCTGGTACGCGAATCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAATTCGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATCGGTTTTGAATATTGC
TGGGAAATTGAGCTGCAGTTGAAGCCTCATGCCGCACCGCCTGCGGTGATCGGCGGCGCGCAGCGGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA
 Primer design