SecReT6
Protein ID: 379699485
SecReT6 ID552
T6SS typei3
Gene symbolsciE
Locus tagSTM474_0281
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]309104..309943 [-]
ProductSciE protein
NoteTagJ
UniProt IDE8XIT4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.50E-46, Aligned region: 148..271
Protein Sequence: 279 a.a.     [Download]
>gi|379699485|ref|YP_005241213.1| SciE protein [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
MEIPPMKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCA
RMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAI
TDTGGQWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDT
HGAWLFTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 840 bp     [Download]
>gi|379699217|ref|NC_016857.1|:c309943-309104 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
ATGGAAATACCGCCCATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACT
CTATTGCGGAGGGGATTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCA
CAGCCTGTTTCAGTTGCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCC
AGGATGGAGGCCAATTATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCC
ACACCGTTTTTCAGGGTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCT
GGCGGCACTCGCCTGTCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATA
ACAGACACGGGCGGGCAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCC
CGGTACTTGAGCTAGTCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATC
GCCGCAACCGACGCGCCTGACTGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACG
CACGGCGCCTGGCTCTTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCAGGG
AAACCGCCTGGCAGGACGGCCCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGCTGACCAG
CCACGGCGATATCAGCCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA
 Primer design