SecReT6
Protein ID: 379699487
SecReT6 ID552
T6SS typei3
Gene symbol-
Locus tagSTM474_0283
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]311185..313824 [+]
Productputative chaperone ATPase
NoteTssH
UniProt IDE8XIT6
KEGG IDseb:STM474_0283
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 609..776
AAA [PF00004], Evalue: 3.40E-19, Aligned region: 236..368
AAA [PF00004], Evalue: 3.40E-19, Aligned region: 381..402
AAA [PF00004], Evalue: 3.40E-19, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 4.00E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 277..315
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 345..405
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 469..522
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 236..402
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 676..706
Sigma54_activat [PF00158], Evalue: 3.50E-06, Aligned region: 232..252
Sigma54_activat [PF00158], Evalue: 3.50E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 2.00E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 2.00E-05, Aligned region: 614..634
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 614..644
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 236..335
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 477..531
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 609..640
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 676..697
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 318..404
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 608..664
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 386..413
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 430..456
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 612..636
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 612..639
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 236..316
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 613..696
AAA_17 [PF13207], Evalue: 0.0029, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.0029, Aligned region: 614..650
AAA_18 [PF13238], Evalue: 0.0047, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.0047, Aligned region: 616..647
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 615..636
Arch_ATPase [PF01637], Evalue: 0.0071, Aligned region: 215..251
Arch_ATPase [PF01637], Evalue: 0.0071, Aligned region: 290..318
Arch_ATPase [PF01637], Evalue: 0.0071, Aligned region: 381..409
Arch_ATPase [PF01637], Evalue: 0.0071, Aligned region: 613..628
Hpr_kinase_C [PF07475], Evalue: 0.0094, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0094, Aligned region: 612..633
Protein Sequence: 879 a.a.     [Download]
>gi|379699487|ref|YP_005241215.1| putative chaperone ATPase [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEK
ALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALMARIFSLNNEL
TASESRWQRELELVHTLQELRLAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
ELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLPLDETSRGVIARLHLDRLVARMSEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|379699217|ref|NC_016857.1|:311185-313824 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGCTCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAA
GCGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGCGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GCCCTTACGACGGCTCCGGCCTGGCATCAGCCATTCCCGGTGAAAGCAGTCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGCTGGCAAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATA
ATCCACTACTGACTGGTGAGGCGGGCGTCGGGAAAACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGC
GCAGGGGGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTACTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTTGATGAAGTTCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGTCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCCATCAGCCTGCTGGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGCCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGATGGCGCGAATTTTCTCGCTCAACAATGAACTG
ACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTCTCGCAG
AGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGCAGGGCGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGGTTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCTGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCGGAGGCTATCTACGGCGGCGAGCAGAACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCTC
ACACCGTTTCCACGCTGAAAGGCGCGCCGCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCGGTGCGTCGCCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAC
GAACTCTTCTATCAGGTGTTTGACAAGGGTGGGATGGAGGACGGCGAGGGTACACATGTCGATTTCAAAA
ACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCCTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTGCGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCCGCTGGACGAAACGTCGCGTGGCGTGATTGCCCGTCTGC
ACCTTGACCGGCTGGTGGCGCGGATGAGTGAACAGCACGGCGTGACGCTGACGTATAGCGAGGAACTGGT
CGCACATATTGTGGCGTGCTGTCCAATGCATGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAG
CACATTCTGCCACGACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCCGCGATCAGGCAGATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGATCGTTTGCTGA
 Primer design