SecReT6
Protein ID: 379699489
SecReT6 ID552
T6SS typei3
Gene symbol-
Locus tagSTM474_0285
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]314490..315983 [+]
ProductSciI protein
NoteTssC
UniProt IDE8XIT8
KEGG IDseb:STM474_0285
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-191, Aligned region: 64..490
Protein Sequence: 497 a.a.     [Download]
>gi|379699489|ref|YP_005241217.1| SciI protein [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQI
DFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMF
KKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPR
DLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAA
YAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPL
IHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLP
SVKQGNA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|379699217|ref|NC_016857.1|:314490-315983 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATC
GACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGT
GGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAATTCGCTTCATGAATCT
GTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGATCAAAGCCCGATGTTC
AAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATTGCGGATTACT
ACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGC
GACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACT
CCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGT
GGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCC
TACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGTTGATTCGCGGTGTGG
AATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGGCGGCGTGGACATGAA
ATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTTTATCCCGTTG
ATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTT
CGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGC
TGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCC
GTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAA
ATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTGGTGACAAAACTGCCG
TCAGTGAAGCAGGGCAATGCCTGA
 Primer design