SecReT6
Protein ID: 379699497
SecReT6 ID552
T6SS typei3
Gene symbol-
Locus tagSTM474_0293
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]319747..321090 [+]
Producthypothetical protein
NoteTssK
UniProt IDE8XIU6
KEGG IDseb:STM474_0293
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-138, Aligned region: 20..445
Protein Sequence: 447 a.a.     [Download]
>gi|379699497|ref|YP_005241225.1| hypothetical protein STM474_0293 [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFP
DGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRG
AQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLI
RMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRP
QTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLA
IKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|379699217|ref|NC_016857.1|:319747-321090 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
ATGAGCTGGAATGACCGCGTAGTCTGGAGTGAAGGACAATTTTTACTGCCGCAGATGTTTCAGCAGCAAG
AGCGTTATCTGGAACACGTCATGCATTACCGCAGCCTGCCGCTGACCCCCTTTTTCTGGGGATTCAGCCA
CTACAATATTGATGGCGAAGCGCTGAACATCGGTAAACTGATACTGAAAGAGGCATCAGGGATTTTTCCT
GACGGCACGCCGTTTAACGCACCGGACCACACCCCGCTGCCGCCGCCACTGACCATTCTGCCGGAGCACC
TGAACCAGCAGATTTGTCTGGCGGTACCGGTACGCGCGCCGAACAGCGAAGAAACCACGTTTGACAATAA
CCCGGAATCATTGGCGCGTTTCTCGGTACATGAACACGACATCCGCGACGCCAACTCGCTGGGACGTGGC
GCGCAGTTATTACAGCTCAGTCATCTGCGCCTGCGGCTGCTGCCGGAAAAGGCGGTGACGGGCGCCTGGA
TTGGCCTGCCGTTGACCCGCATCACCGGGTTGAACCCTGACGGGCGGATAGATATCGACCACGACCTGAT
CCCGCCCATCATTAATTATCAGGCCAGTTCACTGATGTGTACCTGGCTGTCGTGGATCAACGATCTCATC
CGGATGCGGGCCGATTCGCTGGCGGAACGGCTGACCGGCAGCGACAACCACGGCCATGAAGCAGCGGAGG
TCTCCGATTACCTGCTGCTGCAAATTCTCAATCGCTTTGAGCCGCTGCTGACTCACCTGGCGAAAACCCC
GCTGGCCCCGGAGGTGCTGTACCGCTACCTGTCCGAACTGGCCGGGGAACTCTCCACCTATGTGCGTCCA
CAAACGCGACGGCCCGCTGAATACAAAGAGTACAAACACCTGACGCCCTATGCCGGGTTGAAATCGCTGG
TTGATGAGGTGCAGTTCCTGCTGAACGCGGTACTGATCCGGGGCGCGCAGCGCATCGAGCTGAAAGAGGG
GACTTACGGCATCCTGAATGCGGTGGTGGCCCCTTCCGATCTTGCCGATTTCAGCACGCTGGTACTGGCG
ATAAAGGCTTCAATGCCGACCGATGTGCTACTGCAACATTTTGCCGCCCAGACCAAAATCGGGCCATCCG
ATCGCCTGCCGGAACTGATCCGCTCGCATCTGCCGGGGCTGGCTTTGCAGGTTCTGCCTGTACCACCGCG
CCAAATCCCGTTTCAGGCCGGATACATCTATTACGACATCCGCCGCGAGGGAGCATTGTGGGAACACATT
GCCCGTTACGGCGGGATGGCCATGCATACCGCCGGGGAATTTCCGGGGCTGGAGACAGAACTGTGGGGAG
TGCGCGATAAATGA
 Primer design