SecReT6
Protein ID: 379699507
SecReT6 ID552
T6SS typei3
Gene symbolrhs1
Locus tagSTM474_0303
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
Repliconchromosome [GenBank: NC_016857] [Browse all T6SS(s) in this replicon]
Location [Strand]332521..336123 [+]
ProductRhs1 protein
NotePAAR
UniProt IDE8XIV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 386..427
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 412..447
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 476..494
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 520..557
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 584..621
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 633..662
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 678..699
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 684..719
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 725..756
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 817..834
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 825..853
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 868..887
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 892..925
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 955..962
RHS_repeat [PF05593], Evalue: 9.60E-31, Aligned region: 979..1001
PAAR_motif [PF05488], Evalue: 2.40E-15, Aligned region: 73..142
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 551..568
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 578..596
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 702..720
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 876..886
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 981..1013
Protein Sequence: 1200 a.a.     [Download]
>gi|379699507|ref|YP_005241235.1| Rhs1 protein [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
MTMYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIG
RSIHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVI
EDGSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGE
LVGMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLR
DDDEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLL
FMETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTG
VVNRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGR
QGETWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQT
QWNGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTQGGVRRETQ
QRDALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQADTVRFEYDRSGWLTAEHAGNGSI
CYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYERDSLHRQIMRTQGQLATYSGYDDDG
LLSWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDGLRGSVVYSYDRSGYLTGRSGQMYD
HDRYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTTRRDQQLEWNAQGQLTRVISGNTETHY
GYDALGRRTRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQGWRTYLYDAEQPYTPVASVTGRGESRQ
VWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFHQPLRLPGQYFDDETGLHYNLFRYY
APECGRFVSQDPIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRWMGPAEYQQMLDTGTVVQSSTGTTHVA
YPADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSIEGRLAKRKGLPVPEMPTAENITVRGE
KINGEVEAKC
 
Nucleotide Sequence: 3603 bp     [Download]
>gi|379699217|ref|NC_016857.1|:332521-336123 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 chromosome, complete genome
GTGACCATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTA
TCGGCGCTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGC
CGGGCTGATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGG
CGCTCCATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGG
CGGCGCGCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTC
GGAAAATATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATT
GAAGACGGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTC
CGGACTGGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGC
GTGGCGGCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAG
CTTGTCGGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGC
AGAAAATCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTA
CGCCAGCCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGC
GATGACGATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGA
CGCCCGGCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGT
GCTGCATTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTG
TTTATGGAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCT
CCAGCAGCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGA
ACTGGTGCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGC
GTGGTGAACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCA
ATGCGACGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGA
CACCAGTGACGGCGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGG
CAGGGGGAGACATGGCAGTGGTGGTACGACAGGGAAACGTATATCACCGCGCACCGGACGCCGGGCGGTG
GAATGTACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGT
GGCGTATGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACG
CAGTGGAACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGT
ACAACGCCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGA
ACAGGGGCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGCAGGGCGGCGTGCGGCGGGAGACGCAG
CAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAGCTACAACC
GGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAGGC
CGACACGGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGTAGCATA
TGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCATC
TGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGCGA
CAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACGGG
CTGCTGAGCTGGCAGCGCAGTCTGGCGTCCGGCAGTGCCCCTGTTCTTCCTGGCCAGCGCCCGGCGCGGC
AGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGCCT
GCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATGAC
CATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGAGCGGTGATGAGCA
ACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGCTATAACGAGTGGGGCGAGCTGACCACGCGGCGCGA
CCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACTAC
GGCTACGATGCGCTGGGGAGGCGAACCCGCAAGGCGACGTACGGGCGGCACACGGGCCATACGGCGCGGA
GCCGGACGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGGAC
CTATCTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAAGCAGGCAG
GTGTGGTATTACCACACGGATGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAACGCTGGTGT
GGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCACCA
GCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCAGATATTAT
GCACCGGAGTGTGGACGGTTTGTCAGTCAGGATCCGATCGGGCTGAGGGGCGGGTTAAACCTTTATCAGT
ATGCGCCAAATCCTCTCAAATATATAGACCCACTTGGTTTAACCGCGACTGTTGGGCGATGGATGGGGCC
TGCGGAATATCAGCAAATGCTTGATACTGGGACAGTAGTACAAAGTTCAACAGGGACAACTCATGTTGCC
TACCCTGCTGATATAGATGCTTTTGGTAAGCAAGCAAAAAATGGTGCTATGTATGTTGAATTTGATGTGC
CTGAAAAATCATTAGTACCTACAAATGAAGGATGGGCAAAAATAGTAGGGCCAGATTCTATCGAAGGGCG
ATTAGCTAAACGCAAAGGTTTGCCTGTTCCTGAAATGCCAACAGCAGAAAACATAACTGTAAGGGGCGAG
AAAATTAATGGGGAAGTTGAAGCAAAATGCTAA
 Primer design