SecReT6
Protein ID: 379703948
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4584
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]21086..24502 [+]
Producthypothetical protein
NoteTssM
UniProt IDH2J167
KEGG IDraq:Rahaq2_4584
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.50E-69, Aligned region: 412..725
DUF1215 [PF06744], Evalue: 1.80E-34, Aligned region: 261..296
DUF1215 [PF06744], Evalue: 1.80E-34, Aligned region: 844..964
Protein Sequence: 1138 a.a.     [Download]
>gi|379703948|ref|YP_005220322.1| hypothetical protein Rahaq2_4584 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MTIRSLIGSAFLFLIFTVIVVGGILTFYPQWAASSVGVGPLSPSGIWTLCLSIAAGLGAIFWLIERMFDR
LGKAGVRIQWRKRKNQQTEAPTVSDTVNPSPSFFTGLDEQMRFRYGRFWRRKVQILWLNGETELVEKIVP
GLTEQNWQEGDDTLLLWGGLPDVPVDPERAMAARQLRPRRPLDGIVHVLDGNQLPGTTSLDETLRQRQKT
DALLGWQAPVYFWVLDTCKWSQEGRETQPVGCLLSGKTSAESVITALDALIPALREQGMSQLAQDTRYDF
LLRLTERLRKEWRAGLSNVLTTVSRGSSPMMLRGLMFSLPSGADKGSSHSWGALPEWQGILQDCRNAQGK
RTGWPWEKILQCALLSLAVVWGTGVLLSLFINQHQIADSHKQATIAADTSQPLASRLNNQLALQQEIAKL
QYRATAGSPWYTRFGLNQNTVQLAALWPLYQANNNVLIRDVSATKLKAKLTDFIRLPPGSPQRDALTQQT
YAELKAYLMMSRPDKADAPFLNQTLMTLWPKRTGVPDGQWQHVGPKLIAFWGQNLPAHPEWKIAQDKNLV
TAVRQILLKQIGQRNAEASLYQAMLKKVANNYPDMTLTDMVGDTDASYLFNTDEVVPGMFTRQAWEEQVQ
DAIDQVVTTRRNEIDWVLTSKSQPASEDISPEALKARLTERYFTDFSNAWLNMVNSLRWQEPGSLSGAIS
QLTLMADVRQSPMVALMNTLAWQGKTGQKNEALADTLVNSAKVLVGKKQQPVIKQTGGPQGPLDAAFGPL
LTIMDGKSNGLNNGNLSFQAYLTRVTQVRLKLQQVTTAPDPQAMTQMLAQTVFQGKAVDLTDTRDYGSLV
AASLGQEWSGFGKAMFVEPMELAWRQVLQPAAGSLNAQWQSTVVNQWDTSFAGRYPFASTGSDASLPVVA
QYLRSDSGRISQFLKTQLGGILHQEGNRWVPDAITSQGLTFNPAFLDAINQLGQLSDIVFAEGDAGLRFE
LMARPSKNVVRTQLAIDGQNLDYFNQMESWQSFKWPGNSYYAGVQLSWRSVSSGMQLFGDFSGNWGLIRL
LEKAQVTQLDSSRYQLVWKTPDGLPLKYILRTEMGNGPLALLALRNFSLPKKVFLDDAPVSSVVAADPGP
VLTDDQDIPAGTGSAGDE
 
Nucleotide Sequence: 3417 bp     [Download]
>gi|379703932|ref|NC_016835.1|:21086-24502 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
GTGACAATCAGATCCCTAATAGGCAGCGCCTTTCTGTTTTTAATTTTTACCGTCATCGTTGTGGGAGGCA
TCCTCACCTTCTATCCACAATGGGCGGCTTCCAGCGTCGGCGTCGGCCCGTTATCACCTTCCGGTATCTG
GACACTTTGTCTGAGTATTGCCGCCGGGCTGGGCGCGATTTTTTGGCTGATCGAGCGTATGTTTGATCGC
CTCGGGAAGGCAGGCGTTCGTATCCAATGGCGTAAACGAAAAAATCAGCAGACAGAGGCACCAACAGTCT
CAGATACCGTGAATCCATCACCTTCATTTTTCACCGGTCTGGACGAGCAGATGCGTTTTCGCTATGGCCG
GTTTTGGCGCAGGAAAGTGCAGATCCTCTGGCTGAACGGAGAAACAGAACTGGTTGAAAAGATTGTGCCG
GGGCTGACAGAGCAAAACTGGCAGGAAGGTGACGATACCTTGCTTTTGTGGGGCGGCTTACCGGATGTGC
CCGTTGATCCTGAACGTGCGATGGCCGCACGACAATTGCGTCCGCGCCGTCCGTTAGACGGAATTGTTCA
TGTACTGGATGGTAATCAGTTACCAGGCACCACCTCACTCGATGAAACCCTGCGTCAGCGCCAAAAAACC
GATGCGCTGCTCGGCTGGCAGGCGCCGGTGTATTTTTGGGTGCTCGACACGTGTAAATGGTCGCAGGAAG
GCCGGGAAACACAACCAGTCGGGTGCTTGTTATCAGGAAAAACTTCAGCAGAATCTGTAATTACCGCACT
GGATGCGCTCATCCCAGCGCTACGTGAGCAAGGGATGTCCCAGCTTGCCCAGGACACCCGATATGACTTT
TTATTGCGTCTTACTGAAAGATTGCGCAAAGAATGGCGCGCGGGCCTGAGTAATGTGCTGACCACGGTTT
CCCGAGGTTCTTCTCCGATGATGTTGCGCGGGCTGATGTTCAGTCTGCCATCCGGCGCAGATAAGGGGTC
TTCACATAGCTGGGGTGCTCTGCCTGAGTGGCAGGGCATTCTTCAGGATTGCCGGAATGCGCAAGGGAAA
CGAACAGGATGGCCATGGGAAAAAATATTGCAATGCGCCCTTCTGTCCCTTGCTGTAGTTTGGGGAACAG
GTGTTCTGCTTTCGCTGTTTATCAATCAGCATCAGATTGCTGACTCTCATAAACAGGCCACTATCGCAGC
CGATACGTCTCAGCCTCTGGCCTCACGCCTGAATAATCAACTGGCACTTCAACAGGAAATCGCGAAATTA
CAGTACCGGGCAACTGCCGGTTCTCCCTGGTATACCCGTTTTGGCCTGAATCAAAATACGGTGCAGCTGG
CGGCACTTTGGCCTTTGTATCAGGCCAACAATAATGTGTTAATCCGGGATGTTTCTGCCACGAAACTTAA
GGCGAAATTAACAGACTTTATCCGGTTACCACCGGGCAGCCCGCAGCGTGATGCCCTGACACAGCAGACC
TATGCTGAGCTTAAAGCCTACCTGATGATGTCGCGTCCGGATAAAGCCGATGCACCGTTTTTAAACCAGA
CTCTGATGACCCTCTGGCCAAAACGCACCGGGGTTCCGGACGGGCAATGGCAACATGTCGGACCCAAACT
GATCGCCTTCTGGGGGCAGAACCTGCCCGCGCATCCGGAATGGAAAATAGCGCAGGATAAAAACCTCGTC
ACCGCAGTCCGGCAGATCCTGCTTAAACAAATTGGCCAGCGCAATGCGGAAGCATCGCTGTATCAGGCCA
TGCTGAAGAAAGTGGCAAATAACTATCCGGATATGACCCTGACAGACATGGTCGGTGATACCGACGCTTC
TTATCTGTTCAACACAGACGAGGTCGTACCGGGAATGTTCACCCGTCAGGCGTGGGAAGAGCAGGTTCAG
GATGCGATTGATCAGGTCGTTACTACCCGACGCAATGAAATTGACTGGGTTCTGACCAGTAAATCCCAAC
CCGCTTCTGAAGACATCTCCCCGGAGGCGCTAAAGGCACGCCTCACCGAACGTTACTTCACTGATTTTAG
CAATGCCTGGCTAAATATGGTTAACAGCCTGCGCTGGCAGGAGCCCGGATCTCTTTCGGGGGCTATTTCC
CAGCTCACGCTGATGGCAGATGTACGCCAGTCTCCGATGGTGGCATTGATGAATACGCTGGCCTGGCAGG
GGAAAACGGGGCAGAAAAACGAAGCTCTGGCCGATACGCTGGTGAATTCAGCGAAAGTTCTGGTGGGTAA
AAAACAACAACCTGTTATTAAACAAACAGGCGGACCACAAGGCCCCCTCGACGCCGCCTTCGGCCCCCTA
CTAACCATCATGGATGGCAAAAGTAACGGGTTAAATAATGGCAACCTCAGCTTTCAGGCCTATTTAACCC
GAGTGACACAGGTCCGCCTGAAACTTCAGCAGGTCACTACCGCACCGGATCCGCAGGCGATGACACAGAT
GCTGGCTCAAACTGTCTTTCAGGGTAAAGCCGTCGATTTAACCGACACCCGTGATTACGGCAGTCTGGTT
GCAGCCAGTCTGGGTCAGGAATGGAGCGGCTTCGGGAAAGCGATGTTTGTGGAACCTATGGAGCTTGCCT
GGCGTCAGGTATTGCAACCCGCCGCCGGCAGTCTGAATGCGCAATGGCAGAGCACCGTGGTGAACCAGTG
GGATACTTCTTTTGCCGGACGTTATCCGTTTGCCAGTACGGGCAGCGATGCATCCTTACCGGTCGTCGCG
CAATATCTCCGCTCTGACTCCGGGCGTATCTCACAATTTCTGAAAACTCAACTCGGTGGCATCTTACACC
AGGAAGGTAACCGCTGGGTGCCGGATGCCATTACCAGTCAGGGGCTGACCTTTAATCCGGCATTCCTTGA
TGCCATCAACCAGTTAGGCCAGTTATCTGACATCGTATTTGCCGAGGGAGATGCAGGCCTACGTTTTGAA
CTGATGGCACGCCCGTCAAAAAATGTTGTCCGCACACAGCTCGCTATCGACGGGCAAAATCTGGATTATT
TTAACCAGATGGAAAGCTGGCAGAGCTTTAAATGGCCGGGAAACTCCTACTATGCCGGTGTGCAACTCAG
CTGGCGCAGTGTCAGTTCCGGTATGCAACTGTTTGGCGACTTTTCTGGAAACTGGGGATTAATACGTTTG
CTTGAAAAAGCCCAGGTTACCCAACTCGACAGCAGCCGTTATCAGCTGGTCTGGAAAACCCCTGATGGTC
TGCCATTGAAATACATACTGAGAACAGAAATGGGCAATGGTCCGCTGGCATTGCTGGCTTTACGTAACTT
CTCTCTGCCCAAAAAAGTATTTTTAGATGATGCACCTGTCTCTTCTGTCGTTGCCGCCGATCCCGGACCC
GTACTGACAGACGATCAGGATATCCCCGCAGGAACGGGCTCTGCCGGAGATGAGTAA
 Primer design