SecReT6
Protein ID: 379704126
SecReT6 ID545
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4769
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]208784..212152 [-]
Producthypothetical protein
NoteTssM
UniProt IDH2J1P5
KEGG IDraq:Rahaq2_4769
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-64, Aligned region: 410..707
DUF1215 [PF06744], Evalue: 2.50E-32, Aligned region: 835..956
Protein Sequence: 1122 a.a.     [Download]
>gi|379704126|ref|YP_005220500.1| hypothetical protein Rahaq2_4769 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MTKSLHLMLVVMLALALSVLWLSVDGETLTHGVAWWATGVILLSYFLLARYAFALELLDFNRPPETQDDA
RITAFDTLRFTLRHRYDWHWKHKQPWLLVTGEAAVVEKIAPGLTQARWQESQNAVLIWCGEADALDLAAV
TQLRDMRGRRAFNAVLWVTDVTAEPQYLWTTQPVPNQTLPAGNSDTVYRQFIALGHTLSWRPPVFGVCLS
EPQWEQDDRPVQSIGCHWPAGTPVSLDDQLSQLAATLIPQGIAQLNENKHWAWLLQLSGDLKHHTGALLR
QRFQPWLGENQRVLAGGIFFMPAAPESASVQQRSHACYLSPAWNGVIAQSRMQQGRRDHLSTGDRLAIGT
LTLAGLWVLGMGISACANRALIADSQALLQAARTPAPMSDTLTRSVALQDNIDRLLWWQQNGSPWLHRFG
LDQRDAVIEALWPAYTRQSQALLITPMVNALKDRLQAFVSLPPGSAERRLAGKLAYQQLKAYLMLMHPEH
ADPAFMQPVLSPLWTVPDGVAPGEWLARSDKLLAFYLQQLPRHPQWKLPADDTLVANVRTILRSQKGISN
SENALYQQVLLSVSPHYADVTLDSLLGEFAGGQLFSTDDTLPGMFTREAWEGEVSDAIDKAAAARHVTSD
WVLDDKGEQQLLTKDPLQYRLTERYFADYTSAWLNFLNSIRWNTSDSLSTSLDQLTRLADARQSPLLALS
RTLRYQGAAGQHREAMGDSLLKSAQKLVSKTTPDAGFAGGRNDPTRVLSETFAPLLAVLPPETPAAGETQ
TVQNTAVVSVSNYLLQVSQTRLQLMQVANASDPQAMAQNLVRSAFSNGDTTLSQGRHYAQLLAASLGGEW
SSFADAAFVQPLEQAWNGVMTPAQQGINSAWQVQVQNPWQAEFTGRYPFDNTKNDADFTQLAHYLTPDTG
LIDQFITRQLAGVLEKQGDSWVPDPLNTQGMSINPDFLSAVNQLSQLGRRVFPQGKPGVTFELQIRPTRN
VVETDLQIDDATLKYFNQLPGWQTFRWPDAASDHPQVSLTYSPVAASGKSADAFQSYFQADGGWAWLRLL
DKAQVEQLDSSRYRLSWQTATRETLNVVLRTQSGGGPLELLTLRRFTLPAQIFTSPGLATDNAEDTTHHD
AR
 
Nucleotide Sequence: 3369 bp     [Download]
>gi|379703932|ref|NC_016835.1|:c212152-208784 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGACTAAAAGCCTTCACCTGATGCTGGTGGTGATGCTCGCCCTGGCCCTGAGCGTCCTGTGGCTGAGCG
TGGACGGGGAAACCCTCACCCACGGCGTAGCCTGGTGGGCAACCGGCGTCATCCTGCTGAGCTATTTTCT
GCTGGCCCGCTACGCCTTCGCCCTGGAATTGCTCGATTTTAACCGCCCGCCCGAGACACAGGACGATGCG
CGCATCACGGCGTTTGATACCCTGCGTTTCACCCTGCGTCACCGCTATGACTGGCACTGGAAACACAAAC
AGCCGTGGCTTTTGGTCACCGGTGAGGCAGCGGTGGTGGAAAAAATCGCCCCCGGCCTGACGCAGGCGCG
CTGGCAGGAAAGCCAGAACGCCGTCCTAATCTGGTGTGGCGAGGCCGATGCGCTGGATTTAGCCGCCGTG
ACGCAGCTGCGCGACATGCGCGGGCGCCGCGCCTTTAACGCCGTGCTGTGGGTCACTGATGTGACGGCTG
AGCCGCAATACCTGTGGACTACGCAGCCGGTGCCTAATCAGACGCTGCCGGCGGGCAACAGCGACACCGT
ATATCGGCAGTTTATCGCGCTCGGGCACACCCTCAGCTGGCGTCCGCCGGTGTTTGGCGTGTGCCTGAGT
GAGCCGCAGTGGGAACAGGACGACCGCCCGGTGCAGAGTATCGGCTGTCACTGGCCGGCGGGCACGCCGG
TCTCACTTGATGACCAGCTCAGTCAGTTGGCCGCCACGCTCATTCCACAGGGCATTGCGCAGCTGAACGA
GAACAAACACTGGGCCTGGCTGCTGCAGCTGTCTGGGGATTTGAAACACCACACCGGCGCGTTGCTCAGG
CAGCGTTTTCAGCCGTGGCTCGGTGAGAATCAGCGCGTGCTGGCCGGCGGCATCTTCTTTATGCCTGCTG
CCCCTGAATCAGCTTCTGTTCAGCAACGCTCCCACGCCTGCTATTTGTCCCCCGCCTGGAACGGCGTTAT
CGCGCAAAGCCGGATGCAACAGGGCCGCCGCGACCACCTGTCCACCGGTGACAGACTGGCCATCGGCACG
CTGACGCTGGCGGGGCTGTGGGTACTCGGCATGGGAATATCTGCCTGTGCCAACCGCGCGCTTATCGCCG
ACAGCCAGGCGCTGCTGCAGGCGGCCCGCACGCCGGCCCCGATGTCCGACACGCTGACCCGCAGCGTCGC
CCTGCAGGACAACATTGACCGCCTGCTGTGGTGGCAGCAAAACGGCTCGCCGTGGCTGCACCGCTTCGGT
CTTGATCAGCGCGATGCGGTGATCGAAGCACTGTGGCCCGCCTATACCCGGCAAAGTCAGGCTCTGCTGA
TAACGCCTATGGTTAACGCGCTGAAAGACCGGCTGCAGGCGTTTGTGTCCCTGCCGCCGGGCTCTGCCGA
ACGACGTCTGGCCGGGAAACTGGCCTATCAGCAGCTGAAAGCTTACCTGATGCTGATGCATCCTGAACAC
GCCGATCCGGCCTTTATGCAGCCGGTGCTGTCTCCTCTGTGGACGGTGCCGGACGGCGTGGCTCCCGGAG
AATGGCTGGCCCGTTCAGACAAACTGCTCGCCTTTTATCTGCAGCAACTGCCGCGCCATCCGCAGTGGAA
GCTGCCTGCCGATGACACTCTGGTGGCCAACGTGCGCACTATTCTGCGCAGCCAGAAAGGCATCAGCAAC
AGCGAAAACGCGCTGTATCAGCAGGTGTTGCTGAGCGTGTCGCCGCACTATGCCGACGTCACGCTCGACA
GCCTGCTTGGAGAGTTTGCCGGCGGTCAGCTGTTCTCCACCGATGACACCCTGCCGGGCATGTTCACCCG
TGAAGCCTGGGAGGGGGAAGTCAGCGACGCGATTGATAAAGCGGCGGCGGCACGCCACGTCACCTCCGAC
TGGGTGCTGGATGATAAAGGCGAACAACAGCTGCTGACCAAAGACCCGCTGCAGTACCGCCTGACCGAAC
GCTACTTTGCCGATTACACCAGCGCCTGGCTCAATTTCCTCAACAGCATCCGCTGGAACACCAGCGACTC
GCTGAGCACCTCCCTCGATCAGCTGACCCGGCTGGCCGATGCCCGTCAGTCGCCGCTGCTGGCCCTGAGC
CGCACCCTGCGTTATCAGGGCGCGGCCGGTCAGCACCGCGAAGCGATGGGGGATTCCCTGCTGAAATCGG
CACAAAAGCTGGTGTCGAAAACCACGCCGGACGCCGGATTTGCCGGCGGGCGCAATGACCCGACCCGCGT
ACTGAGCGAGACCTTCGCCCCGCTGCTGGCCGTGTTACCGCCGGAAACCCCGGCGGCAGGTGAAACGCAA
ACCGTGCAAAACACCGCCGTCGTTTCCGTCAGCAACTATTTGCTGCAGGTGTCACAAACGCGGCTGCAAC
TGATGCAGGTGGCCAATGCCTCCGACCCGCAGGCGATGGCACAAAACCTGGTCAGATCCGCCTTCAGCAA
CGGTGACACCACGCTGTCGCAGGGGCGTCACTACGCACAGCTTCTGGCGGCCAGCCTTGGCGGAGAGTGG
AGCAGCTTTGCCGACGCCGCGTTTGTCCAGCCGCTGGAACAGGCGTGGAACGGCGTGATGACTCCGGCAC
AGCAGGGGATCAACAGCGCCTGGCAGGTTCAGGTGCAGAACCCGTGGCAGGCGGAATTTACCGGACGCTA
CCCGTTCGATAACACCAAAAATGACGCGGATTTCACCCAGCTGGCTCACTATCTGACGCCGGATACCGGC
CTGATTGACCAGTTTATTACCCGGCAACTGGCCGGCGTGCTGGAAAAGCAGGGTGACAGCTGGGTACCTG
ACCCGCTCAACACCCAGGGAATGAGCATCAACCCGGACTTCCTCAGCGCGGTTAACCAGCTGAGCCAGCT
TGGCCGCCGCGTCTTCCCGCAGGGCAAACCCGGCGTGACCTTTGAGCTGCAGATCCGCCCGACCCGCAAC
GTGGTAGAAACTGACCTGCAGATAGACGACGCCACCCTGAAGTACTTTAACCAGCTGCCGGGCTGGCAGA
CGTTCCGCTGGCCAGACGCCGCCAGCGATCATCCACAGGTGTCCCTGACGTACTCACCGGTCGCGGCATC
AGGGAAAAGCGCCGACGCCTTCCAGAGCTATTTTCAGGCGGACGGAGGCTGGGCCTGGCTGCGTTTACTC
GATAAGGCGCAGGTTGAACAGCTCGACAGCAGCCGCTATCGCCTGAGCTGGCAAACCGCCACCAGAGAGA
CGCTGAACGTGGTGTTACGCACCCAAAGCGGCGGTGGCCCGCTGGAACTGCTGACCCTGCGACGCTTTAC
GTTGCCGGCCCAAATATTTACCTCTCCGGGCCTGGCCACGGACAATGCGGAGGACACAACGCACCATGAC
GCCCGATAA
 Primer design