SecReT6
Protein ID: 379704227
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4876
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]328257..331694 [+]
Producthypothetical protein
NoteTssM
UniProt IDH2J1Z6
KEGG IDraq:Rahaq2_4876
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-29, Aligned region: 184..346
ImcF-related_N [PF14331], Evalue: 3.10E-29, Aligned region: 350..370
ImcF-related_N [PF14331], Evalue: 3.10E-29, Aligned region: 768..805
ImcF-related_N [PF14331], Evalue: 3.10E-29, Aligned region: 1095..1138
Protein Sequence: 1145 a.a.     [Download]
>gi|379704227|ref|YP_005220601.1| hypothetical protein Rahaq2_4876 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MFKKLLSFVAWTLFLCLLLIICVVMSVALEQTLLHAFILWLILIVVVLFSRFVWGSVSGIAQAKYISSLK
AKFKLTRLEYVLFEHWKTGAAVIKRIRRRKQPIPWFVLTGGRSGKTTLMAGAGLPLFSNEPESSLVVPTR
TLRWWFFRSAGFLDLSSHFLSKTPAFERGWLRLVNWCARLPAPAGIVVCVSVSELLEQDDAELHLHARHI
RTQIEPLVSKVRRRLPVYLFITCCDRMPGFSHWANKLSAVQRQQPLGYYWRDSPVVDGKDPALLDPLFAC
VKDGLDKVRVSMLSGGEPDGETLALMDFPEQLPQLQPAMQRYLAALCEPDAYFQPAALGGIWFTATEPVS
KNSASRQAFFIHDLMTRLLPALSRQRDIEPVGFGRRYLHKWGAMTCSALAIMYLLVSGYFTRHLTDGTPT
QMDIMAQVQQLENIEGWNAHPLKYLPFVPVINHRHAQLEASILAASPRDKVNLHEIADNYQQQFNDAVPQ
QKRALILDLASTLITKQAMWEKQPVSALVKRAPVPAALSMTGATVPLPPQQDVVLQRALLQLPEGGEQLA
VLRELLGRLVNSDPQMAWLVAPSDDLTPVNLTDFLPWSEDKTQISGLWTLQGTAQIQNWLEEIRRAGSQQ
VPMPELAAFEQRWPALRQTQWMTMMLAMDQQSAPALTHEQWQTALIALDQGNSPSMKFARYINEQLEDIS
AHDAARWLRELRRLNQLQAMSVPGALVPRISKFQQSVQKKIATWLKIDSKTLKPVVSDLNIKNWNAWQTS
LHAAVADVFATPKSSDRLTRGLFQTGAAGDSNPLQLLDSRFNVMRKSLSAEHDDFAINAVWALYQNDARW
LVAHAMQRSACWLEQQWQSRVLWPMENNASRLEYDDQQDLAWQYLSDFIRGPAKSVLVVEDNGPKAGEFN
GQTPGLTPEFLRMVNHVLRPDDVLAMPERESTRNDDALSALKDEQSELEAQMAELEAKPLELTLKSLPAT
IPGGARLMPVGTRLTLFCDEQQWKLNSMNFSEQATFHWRPGHCSRATLMINFPGFDLTYEYFGDAAWPDF
LHDISDGQHRFKAEDFPDEAAQLAALGIKEVMVRYQSAAQNLIQDSWHQWQALSQALNDNAQAQQEAGSR
NAEKKRPTALKSAFSQLPVRITECH
 
Nucleotide Sequence: 3438 bp     [Download]
>gi|379703932|ref|NC_016835.1|:328257-331694 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTTTAAAAAATTACTTTCCTTTGTCGCATGGACACTATTTCTGTGCCTGTTGCTTATTATCTGCGTCG
TCATGTCCGTCGCTTTAGAACAGACACTTCTGCATGCATTCATTTTGTGGCTGATATTGATCGTCGTCGT
TTTATTCTCCCGGTTTGTCTGGGGATCAGTTTCCGGTATTGCGCAGGCGAAATATATTTCCTCGCTGAAG
GCTAAATTTAAACTTACCCGGCTGGAATATGTTTTATTCGAACACTGGAAAACCGGTGCCGCGGTAATTA
AGCGTATCAGAAGACGCAAACAGCCAATACCCTGGTTTGTCCTGACTGGCGGGCGAAGTGGTAAAACGAC
GCTGATGGCCGGTGCAGGATTACCGCTGTTTTCCAATGAACCGGAAAGCTCTCTGGTGGTGCCGACCCGC
ACCCTACGCTGGTGGTTTTTTCGCTCTGCAGGTTTTCTCGATCTCTCCAGCCATTTTCTGAGTAAAACCC
CGGCCTTCGAGCGCGGCTGGTTGCGGCTGGTGAACTGGTGCGCCCGTCTGCCTGCGCCAGCTGGCATCGT
GGTGTGCGTGTCGGTCAGTGAGTTGCTTGAACAAGATGATGCGGAACTGCATTTGCATGCGCGGCATATC
CGCACGCAGATCGAACCGCTGGTGAGTAAAGTCAGACGTCGTCTGCCGGTGTATCTGTTTATCACCTGCT
GTGACCGGATGCCTGGCTTCAGCCATTGGGCTAATAAACTCTCAGCAGTACAACGTCAGCAACCGCTGGG
TTACTACTGGCGCGACTCGCCTGTCGTCGACGGGAAAGATCCGGCCTTGCTGGATCCGCTGTTTGCGTGC
GTGAAGGACGGCCTGGATAAAGTGCGTGTGAGCATGCTTTCCGGTGGTGAACCGGATGGCGAAACGCTGG
CGCTGATGGATTTCCCGGAACAACTGCCGCAACTGCAACCGGCAATGCAGCGTTATCTGGCCGCCCTGTG
CGAACCGGACGCTTACTTTCAGCCTGCGGCACTGGGTGGCATCTGGTTTACCGCCACTGAACCCGTCAGC
AAAAACAGTGCTTCGCGTCAGGCTTTCTTTATCCATGATCTGATGACCCGGTTATTGCCTGCGCTAAGCC
GCCAGCGAGATATTGAACCTGTTGGGTTTGGCCGTCGCTATCTGCACAAATGGGGCGCGATGACCTGCAG
TGCGCTGGCGATAATGTATCTGCTGGTTTCCGGTTATTTCACCCGCCACCTCACTGACGGCACGCCCACG
CAAATGGATATCATGGCGCAGGTACAGCAGCTTGAAAACATCGAGGGCTGGAACGCGCATCCGCTGAAAT
ATTTACCTTTTGTTCCTGTTATCAACCATCGCCATGCGCAGCTTGAGGCCAGCATTCTTGCGGCATCCCC
GCGCGACAAGGTGAACCTGCATGAGATAGCAGATAACTACCAGCAGCAGTTCAACGACGCTGTTCCACAG
CAAAAACGCGCCCTGATCCTGGACCTGGCAAGCACACTTATCACCAAACAGGCTATGTGGGAAAAACAGC
CTGTCAGTGCGCTGGTAAAACGGGCACCGGTTCCGGCGGCGCTGAGCATGACAGGGGCAACGGTGCCTTT
ACCCCCTCAGCAGGATGTGGTGCTGCAACGCGCGTTGTTACAGTTGCCGGAAGGTGGTGAACAACTTGCG
GTACTGCGTGAATTGCTGGGACGTCTGGTCAACAGTGATCCGCAGATGGCATGGCTGGTGGCACCTTCAG
ACGATCTGACGCCGGTGAATCTGACGGATTTCCTGCCCTGGTCTGAGGATAAAACCCAGATCAGCGGGCT
GTGGACGCTACAGGGCACCGCGCAAATTCAGAACTGGCTGGAGGAGATCCGCCGCGCTGGCAGTCAGCAG
GTTCCTATGCCTGAACTGGCTGCCTTTGAACAGCGCTGGCCTGCGCTGCGTCAGACGCAATGGATGACGA
TGATGCTGGCGATGGATCAGCAATCGGCTCCGGCTCTGACTCACGAACAGTGGCAAACCGCACTGATTGC
GCTCGATCAGGGTAACAGCCCGTCGATGAAATTTGCCCGTTACATCAATGAACAGCTAGAGGACATCAGC
GCTCATGACGCCGCGCGCTGGCTGCGCGAACTGCGCCGGTTGAATCAGTTACAGGCCATGTCGGTACCGG
GTGCGCTGGTACCGCGCATCAGTAAGTTCCAGCAGTCTGTTCAGAAGAAAATTGCAACATGGCTGAAAAT
CGACAGCAAAACGCTGAAGCCGGTGGTTTCCGATCTCAATATCAAAAACTGGAATGCCTGGCAAACCAGC
CTGCATGCAGCGGTTGCGGACGTGTTTGCCACGCCGAAAAGCAGCGACCGGCTGACCCGCGGGCTGTTCC
AGACCGGCGCTGCCGGAGACAGCAATCCTTTGCAACTGCTTGATAGCCGTTTCAATGTGATGCGTAAAAG
TTTGTCAGCGGAACACGATGATTTTGCCATCAACGCCGTGTGGGCACTGTATCAGAACGATGCACGCTGG
CTGGTGGCGCATGCCATGCAGCGTTCTGCCTGCTGGCTTGAGCAGCAATGGCAAAGCCGGGTGCTGTGGC
CGATGGAAAATAACGCCAGCCGTCTGGAGTACGACGACCAACAGGATCTGGCGTGGCAATACCTGTCTGA
CTTTATCCGCGGACCGGCAAAAAGTGTACTGGTGGTGGAAGATAACGGGCCAAAAGCAGGCGAGTTCAAC
GGGCAGACGCCGGGACTGACACCGGAATTCCTGCGGATGGTTAATCACGTTCTGCGCCCGGATGATGTGC
TGGCGATGCCTGAACGTGAAAGTACCCGCAATGACGATGCGCTGTCCGCGCTGAAAGATGAACAAAGCGA
GCTGGAGGCGCAGATGGCGGAACTGGAAGCCAAACCGCTGGAACTGACACTCAAAAGCCTGCCTGCCACC
ATTCCGGGCGGGGCACGACTGATGCCGGTGGGCACCCGCCTGACGCTGTTCTGTGATGAGCAACAGTGGA
AACTCAACAGCATGAACTTCAGCGAACAGGCGACGTTTCACTGGCGTCCGGGCCATTGCAGTCGTGCAAC
GCTGATGATCAATTTCCCGGGTTTCGACCTGACTTATGAATACTTTGGTGACGCTGCCTGGCCGGATTTC
CTGCACGATATCTCAGACGGACAACACCGCTTCAAAGCCGAGGATTTTCCTGATGAGGCAGCACAACTGG
CGGCTCTGGGCATAAAAGAAGTCATGGTTCGTTATCAGTCCGCTGCACAGAATCTGATCCAGGATAGCTG
GCACCAGTGGCAGGCGCTCAGTCAGGCACTGAATGATAATGCGCAGGCGCAGCAGGAAGCCGGCAGCAGA
AACGCGGAAAAAAAACGACCAACGGCACTGAAGAGCGCGTTCTCACAACTGCCTGTCCGTATCACCGAAT
GTCATTGA
 Primer design