SecReT6
Protein ID: 379717633
SecReT6 ID769
T6SS typeii
Gene symbol-
Locus tagFTU_1369
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1455732..1458194 [+]
Producthypothetical protein
NotePdpA
UniProt IDH6LWE5
KEGG IDftg:FTU_1369, ftg:FTU_1703
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|379717633|ref|YP_005305969.1| hypothetical protein FTU_1369 [Francisella tularensis subsp. tularensis TIGB03]
MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIINYKLLNINLINTQLKNTKILYRKGLI
SKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLT
SIDSAIQRSSDLNKTIIKQLNKLKSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFK
HNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKD
HHKRTTRFMAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDD
IFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVD
QVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQKKEDRKISDTLIK
PFSSILKDNLQSVEYIQSNNDDIQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLY
ISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNLITYKIKDYSNLTPEYPKY
KSFSNFYINGRVTIGENVNNDSKKAYKFFKNYKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEM
LSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEMQSFTKGEIIELISNSAISTKKAQQQLLQRQL
LGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1455732-1458194 Francisella tularensis TIGB03 chromosome, complete genome
ATGATAGCAGTAAAAGATATAACTGATTTAAATATACAAGACATAATTAGTCAGTTAACTTCTGAAGTTA
TAAATGGCGACACAACCTCTTCTTCTGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAA
ACTATTAAACATTAATCTTATTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATA
TCTAAGCTTGATTACGAAAAATATAAAAGATATTGCGTAATATGTAGATTAAAAAATAACATAGATGAAT
TTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAGCTTAAAAATCGCAATTAAAGAATTACAAAA
CTCATGCTCATCAAGTTTAATTCTTGAGCTCCCTCATGATTACATAAGAAAAATTGATGTCTTACTAACT
AGTATAGATAGTGCGATACAAAGATCAAGTGATCTCAACAAAACAATTATAAAACAGTTAAATAAGCTTA
AAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTGCAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAG
CATAACTCTCTTACACTTAAAAACCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAA
ATGGCTGGTTAACTTTTGATTTAGCATATATCAATAATCACAAAGACTTTAACTTCCTATTAAGCCCAAA
TCAACCCATATTACTTGATATTCAAATTAATGATAGCTTCAATTTTTACAAAAAAGAATCTAAAAAAGAT
CATCATAAGAGAACAACCCGTTTTATGGCCATTGGCTTTAATTCAAACAGTATAGATATTCATGAGAACT
TTGAATACAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAAAAATTTAAAATACAATTCCA
TGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCTTATATAGCTTTAAATAAAAGCTTAGATGAT
ATCTTTAAAGAGAATTTTTTCTTTGATAATTTAGTTTCTTTAGATACCAACAAAAGTAATAACCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTTTTTATTCAACAACTTGA
GCAAAATAAATGCTATTTAAAATATTTCTGTGATAAGAAGAGTGGCAAAGTAAGCTATCATGTTGTAGAT
CAAGTAGATAATGACTTACAAAGGAATATCGTAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTT
ATGATATAAGCTGCTTCAAAAAACAAATTCTAATCTCAAATAAATCAAACTTTTATGTTAAAGAAAAAAA
TATATGTCCTGATGTGACTTTAAACACTCAAAAAAAGGAAGATCGAAAGATTTCAGATACCTTAATAAAG
CCATTCTCATCCATACTCAAGGATAACTTACAATCTGTAGAGTATATACAAAGCAATAATGATGATATAC
AAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCTTAGATACTGA
AATTACTCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAAGCTTATAT
ATAAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTAAACAACTATATGAAAACTTACATA
ATTTTCACTATAAAAGTGATTCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCT
GACACATGACAACTTAATAACTTATAAAATTAAGGATTATAGTAATCTAACTCCTGAATATCCTAAGTAC
AAAAGTTTTAGTAACTTTTATATTAATGGTAGAGTAACGATTGGAGAAAATGTTAATAATGACTCCAAAA
AAGCTTATAAATTCTTTAAAAATTATAAGCCAGAAGAAAGCTCAATCGCAGAATTTCAAGAAAATGGTGA
AAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAATAGAAATTGCCAAGGAAATG
TTATCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAATTCTGCTAATA
ATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATGCAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCGAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTT
CTTGGATCTAAAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTC
AAGTAAATGAAGATTGTGAGAATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATC
AAAAGGAAATTAA
 Primer design