SecReT6
Protein ID: 379717635
SecReT6 ID769
T6SS typeii
Gene symbol-
Locus tagFTU_1371
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1461470..1461847 [+]
Producthypothetical protein
NoteIglE
UniProt IDH6LTE4
KEGG IDftg:FTU_1371, ftg:FTU_1705
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|379717635|ref|YP_005305971.1| hypothetical protein FTU_1371 [Francisella tularensis subsp. tularensis TIGB03]
MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLN
LKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1461470-1461847 Francisella tularensis TIGB03 chromosome, complete genome
ATGTACAATAAATTATTGAAAAATTTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTA
GTGATGGTTTGTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAA
TATTTTCTACTCAGATAACTATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTTAAAACAGGAAAGAATGAATTTCCATTAGATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTC
CTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAGTTCAGATTCTGTAAATAAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGATTAA
 Primer design