SecReT6
Protein ID: 379717642
SecReT6 ID769
T6SS typeii
Gene symbol-
Locus tagFTU_1378
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1467886..1468602 [+]
Producthypothetical protein
NoteIglJ
UniProt IDH6LWF4
KEGG IDftg:FTU_1378, ftg:FTU_1712
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 238 a.a.     [Download]
>gi|379717642|ref|YP_005305978.1| hypothetical protein FTU_1378 [Francisella tularensis subsp. tularensis TIGB03]
MQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDNKETLNVKINIFKIKPFTKL
QSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSED
YCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKI
TNLPFKIELEISIENNKKNQIYLGYFNL
 
Nucleotide Sequence: 717 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1467886-1468602 Francisella tularensis TIGB03 chromosome, complete genome
ATGCAACACATCAATAATATCAATAAAAATATCTCTCTAAATAACTTTGTAAGTCTTCTAAAAAGTCAGA
AATATTCTTTGAAAAGAATAAATTTCATACCGGTAATGATTAATAAAACCTCATCTCCTACCATATTAGA
TATTTATGATAATAAAGAAACTCTAAATGTAAAAATAAATATCTTTAAAATCAAACCATTCACTAAATTA
CAGAGTATTTATCAAGAATATATCCAAAACAATAATGACTTGGCTATTGAGATACTTGGATACGGATTAA
AAGTGCTACTAAAGTTATACATTTTAGATACTAAAGCACTGCACAAATTCACAACAAAAAATAGTTATTA
TATTCAATGTGCTCCCAAATACACTATAGATAACATAATAAACAATATCTATAAATTACTCTCGGAAGAC
TATTGCACAGTAATAGATTATAAAGAAAAACTAATCAATATAAAGAGAAAACAAATAGTAGTAGGAGATT
CTTACGTTGGAAAATCTTTCTTGGGGGCATATATTCCCTCATATGTTTATATTATAAACATTAAGATATA
TCTCATTAGTAAAAATCAATATGTCATAAATAAAATCAAAACTCAAATTAAAAAAATTGAGGAAAAAATT
ACAAATCTCCCATTTAAGATAGAACTTGAAATATCAATTGAAAATAATAAAAAAAATCAGATATACCTAG
GTTATTTTAATTTATGA
 Primer design