SecReT6
Protein ID: 379717643
SecReT6 ID769
T6SS typeii
Gene symbolpdpC1
Locus tagFTU_1379
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1468642..1472628 [+]
ProductPathogenicity determinant protein C
NotePdpC
UniProt IDH6LWF5
KEGG IDftg:FTU_1379, ftg:FTU_1713
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1328 a.a.     [Download]
>gi|379717643|ref|YP_005305979.1| Pathogenicity determinant protein C [Francisella tularensis subsp. tularensis TIGB03]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLACMRRLRAIHPSKIAMQ
KIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKINITSEKKNLEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLL
ENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKSGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKILSFTKYKEKYNFLNNDKLREEH
ANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFI
VCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSY
IPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGMSLFS
LNLTNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLYMTYLYC
IFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFKALVEKYENSIKPNSKVL
KENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERNCTLLEQYSRKKKAETGLVQDGEKIKV
VNNYNSYAAINQYQHFVSLGIMYDSGAKYSYSHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNK
KSKEKTQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRV
SPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQ
EAANAFIDALYYIRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNRASKPVIERF
LIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADAYKKNNYKNEINFRAWFESIFHVQN
LSLSPNYIGNNILILSLVEELKPKCSEYKKNMINQQIIAKANELNFYQLLIRLIEISTYHRILTKSIITN
TTSLLYDILNKPEFQTINKLINKLFIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS
 
Nucleotide Sequence: 3987 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1468642-1472628 Francisella tularensis TIGB03 chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGTAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATGTATGAGGAGATTAAGAGCTATTCATCCCTCAAAAATAGCGATGCAA
AAAATTAAATCAATTCGCAATAAAAAAAATTCTTTTATAATTGCCATTTTATCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCACTTTTGGACATAAAACCGTTATTTTTGATTTTAAGAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAGAGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTACTTCTGAAAAGAAAAATCTAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGCGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGAGGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCGCTAGTCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAATCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCTCAGGCTTTATGTGAGTTTCTTGATGAAGAGAATATTAACCCGA
AAATTAATCCTATAAATTCTAAAAAGCTATATAAAACCTACAAAGAAAATTATAAAAGCGATTCAGAAAA
AATTTTAAGTTTCACAAAATACAAAGAGAAATATAATTTTTTAAATAATGATAAGCTTAGAGAAGAACAT
GCAAATAAACTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTAT
GTTCAACTAAAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTAT
GCTAGAAACCGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATA
GTATGCTATCTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATA
AGAAAGAAAATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAATTCAAAGCAGAAATATAT
AAAAGATTTTATCGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTAT
ATACCAGTAGCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTT
CTAATCGAATGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTCAGAAAAAGAGGA
AATGATTATGCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAATGTCTTTATTTAGC
CTTAATCTAACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATC
TTGATTTCAAGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTCGGGATGGC
AACTACAAAAAAAAATGGAGATATCGTAATTGATGAAGATCAAGTGCTATATATGACATACTTATACTGC
ATTTTCATGGCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCCTCAAATACTTATATGTTAA
ACTCTAAAGAGGAAAAGTATCCTATAGCCAATATAGCTAATTTTTTTGCTAGACCTGTATTTAAACTTTC
TAAGGATAAAGAGTTTAAAGCATTAGTTGAAAAGTATGAAAATAGCATAAAACCTAATTCAAAAGTTCTC
AAAGAAAATTATATAAGTAGAGTAACGACGTTATCCGAGGTATATGAAGATATATATAATTTAAATTGCT
TATATAGTTCTCTATCAGAAGGATCCTTGTATAACCTATTATCAACTCATAGTGAAAGAAACTGTACTTT
ATTAGAGCAGTATTCTCGTAAGAAGAAAGCGGAGACAGGATTGGTCCAAGATGGAGAGAAAATAAAAGTC
GTAAACAACTACAATAGCTATGCTGCGATTAATCAATATCAACATTTTGTATCACTAGGCATAATGTATG
ATAGTGGTGCAAAATACTCCTATTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTCACCAGA
TAAAGAACAGATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAA
AAGAGCAAAGAAAAAACTCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGAT
ATTTTAACGATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTA
TTTAGTAAACTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGTT
TCACCAGAATTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAAT
ATATTAGTTTTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTA
TGAGATATGGGTCGGACTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAA
GAAGCTGCTAATGCTTTTATCGATGCTTTATATTATATTAGATTAATGCAATTATATTATGGCAAAACTA
TACCTTTTTTGTGGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAAC
AGAAGAAAACTTTGAAAATATACTTAAAATTGCTCTTAATAGAGCCTCAAAACCAGTAATAGAAAGATTC
TTAATTATTCTTAACATATATAATAACACTATTGATGATAATACTTTAATTTTAATACGATGCCGTTTAA
CAATAATATTATTTGAACATGAAGAGCAGAAACTCAAATTAAAAGCTTTACAAAAATATGCTGACGCTTA
TAAAAAAAATAATTATAAAAACGAAATTAATTTTAGAGCTTGGTTTGAATCTATATTTCATGTTCAAAAC
TTATCCTTATCTCCTAATTATATTGGCAATAATATTTTAATCTTGAGTTTAGTTGAAGAATTAAAACCAA
AATGTAGTGAATATAAAAAAAACATGATTAACCAACAAATTATAGCTAAAGCAAACGAGTTAAACTTTTA
TCAACTTCTAATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAATCATAACTAAT
ACAACCTCGTTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATTAATAAATAAGC
TATTTATTTATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTAT
TGAAAAAACCTATAAGAAAATAAATAGCTTATATAAATCAGACTTTTTTAAAAAAATATCATCATAG
 Primer design