SecReT6
Protein ID: 379717644
SecReT6 ID769
T6SS typeii
Gene symbol-
Locus tagFTU_1380
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1472646..1473221 [+]
Producthypothetical protein
NotePdpE
UniProt IDH6LWF6
KEGG IDftg:FTU_1380, ftg:FTU_1714
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|379717644|ref|YP_005305980.1| hypothetical protein FTU_1380 [Francisella tularensis subsp. tularensis TIGB03]
MSKKIFKLLSISIIFSIYQQTFSNTIIASTFELKNSSKKNATIFLNLNEFCPTNIAACKDENDNNCIYIT
ELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFKNNKHETYYSQVIYNWFVSSE
LYLSFSEGSIFINKDINNSNNYDKGNFLSVNLERIADGWAPPHYEKKITII
 
Nucleotide Sequence: 576 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1472646-1473221 Francisella tularensis TIGB03 chromosome, complete genome
ATGAGTAAAAAAATATTTAAATTATTATCAATTTCAATAATATTTAGTATATATCAACAAACATTTAGTA
ATACAATAATAGCTAGTACATTCGAACTAAAAAATAGTTCTAAAAAAAATGCTACTATCTTTCTAAATTT
GAACGAGTTCTGTCCGACTAATATAGCAGCATGCAAAGATGAGAATGACAATAATTGTATTTATATAACT
GAATTAGTTAGAGAACCTCTTAGTCGTATTTACTATTACTTAGCCGTGCCAATTACCAGCAAATCAGTTA
AAGACTTAACAATATTATATAAACATGATAAAGAAGAATCTCCACCAGAAGCAATAAATATATGTTTGAG
TTTATTTAAAAATAATAAGCATGAAACATACTATTCTCAAGTTATATATAATTGGTTTGTATCTTCAGAA
TTATATTTATCATTTAGTGAAGGATCTATTTTTATAAATAAAGATATTAATAATTCTAATAATTATGATA
AAGGTAATTTTCTAAGCGTAAATCTCGAACGTATAGCTGATGGCTGGGCCCCTCCTCATTATGAAAAGAA
AATTACTATAATATAA
 Primer design