SecReT6
Protein ID: 379717645
SecReT6 ID769
T6SS typeii
Gene symboliglD1
Locus tagFTU_1381
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1473228..1474424 [-]
ProductIntracellular growth locus subunit D
NoteIglD
UniProt IDH6LWF7
KEGG IDftg:FTU_1381, ftg:FTU_1715
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0027, Aligned region: 43..103
DUF876 [PF05936], Evalue: 0.0027, Aligned region: 185..345
Protein Sequence: 398 a.a.     [Download]
>gi|379717645|ref|YP_005305981.1| Intracellular growth locus subunit D [Francisella tularensis subsp. tularensis TIGB03]
MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIVSFDLDVESLQTGLILIKDLKLYLDE
KNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREKVIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALFRLD
RGRLVPEIYDFPLLTLNHYYLGDIFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAES
NRANSYPKQIFDLIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELH
GKKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGVKLVDVECSMI
NFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|379716390|ref|NC_016933.1|:c1474424-1473228 Francisella tularensis TIGB03 chromosome, complete genome
ATGTTTCTAGAAAGGATTTATTGGGAAGATGGTTTAAGATTAGATAGCGATATTTTAGATAAGTCAAATC
TATCTGTTTTAGAAAGGTTAAGCACCGCAAGCTATTTGCCAGCTAATCTTAATAAGGGAATCGTTAGCTT
TGATTTAGATGTTGAAAGTTTGCAGACAGGTCTTATCCTTATAAAAGATCTTAAATTGTACTTAGATGAA
AAAAATTTTGTTTTTTATGATAAGTCTTATCCGTTATCTTTACAAATAATGACTGATAAGTTAAGTGATG
AAATCCCCTTATTTCTGAATATCAGAGAGAAAGTAATTGAAAAAAATGGGATTAAATATATCTATAATCA
ATTGTCATTATCATTAGAGCATAGCTATGGTTTTAAACATAGCATCCAAATTGCATTATTTAGGTTAGAT
AGAGGGCGATTAGTACCAGAAATTTATGACTTCCCGCTATTAACTCTTAATCATTATTATTTAGGTGATA
TTTTTGTAAAACTTAATAGGACTGTTTCTGAACTAAAGTCTTTTAATCGCTTTGTTTTTTCAGCTTCAAG
ATCTTATGCGTCAATATTACTTGTATTTTTGATTAATAAATTAGAAAGAGAATTGAAGTTCGCAGAATCT
AATAGGGCAAATAGTTACCCGAAACAAATATTTGATTTAATTGATGATATTTACAGCTTAATTCAACTTA
ACCTAGATAAAGTTGAAGAGCTTGATAGCATTGAATTTGATTTCCAAAAGCCTTTGACTAAATTAAATCT
ACTTGCTGATAGATTGTTAACTCTTTGTGAGTATAGAAAGATTAATAACTTTATCAGATTTGAATTGCAT
GGAAAAAAATATATATGTGAAAGCTTTCCTGAAGAGTTTTTTGTTGCTACTAGATACTATCTTTTCCTTA
AAAGGAAAGCAACAGCTCCAGCCAATGTAAGGTTTGAAAATAAGAATGCTCTGAGAATTACTAGTATAAG
TAGAAATAAGAATATTGTAGCTCTGTCTCTTTCAGGAGTAAAACTGGTTGACGTTGAATGTTCTATGATT
AATTTTACAACTAGATTTGATAATATCGATGCAATATATGAAATTCAAAAAGGTTCTGAGTGGGATTTTA
TATTAGCGGATAGTAGTGCGGTTTTTACGGCTTTTGAAGGTAGTGAGAATTTTGATTTCTTTATAGCCTT
TTCTTAA
 Primer design