SecReT6
Protein ID: 379717935
SecReT6 ID770
T6SS typeii
Gene symbol-
Locus tagFTU_1704
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1851497..1854778 [+]
Producthypothetical protein
NotePdpB
UniProt IDH6LTE3
KEGG IDftg:FTU_1370, ftg:FTU_1704
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.00056, Aligned region: 847..942
Protein Sequence: 1093 a.a.     [Download]
>gi|379717935|ref|YP_005306271.1| hypothetical protein FTU_1704 [Francisella tularensis subsp. tularensis TIGB03]
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKVKNNLSELYIF
YGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISN
DYYHENIKISEIYKELLKLRLKNFIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILS
SKDDVNNKYNNVKILNQIRRWLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSSPKSIIINLIS
LLFSFIFIVNIFQEINIKEKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIKYHFIYEQYAD
TLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVIKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYKCATDNAILDL
NDNYIIPIEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKS
LEKNAKDVADDGKKQTSSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIY
SKEYIKDNIDPTNKKFNRLINNLKDNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNI
SNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQNNTNDQND
KSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINTIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNG
YIYSGFIEQLSPLLSYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKRNPKAIKFDITPIPNK
DNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKDAN
CDQNNICTWVIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ
 
Nucleotide Sequence: 3282 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1851497-1854778 Francisella tularensis TIGB03 chromosome, complete genome
ATGAATTTTATTAAAAATCATCAAATATTAATAATTTCACTAACTATAGCAATAATTGTTTTATCAGTAC
TTGGTATTTTTATGATTAAAAAATGGCTTAAAACATCAAGAAATCCTAACAAAAAATCTGCCTCAAAGAC
CATAAAAAATGCAAAATCATTGATCAAAAAGAATAAAGTAAAAAACAACTTAAGTGAATTGTATATTTTC
TATGGGGACTATCTGGCAGCTAAAGATTATATAACAAAGATAAAACCTCAAGCTCAAATCATTGATAATA
ATGAACTCCCTTTAATAGCTATTGATAAAAACAATACATCTCTCGTATTTGCAAATAATGAATTTTCGTA
CCTATATAAGTTAAAAAAGAAACTAAATCTACAATTTTATAAGCTTAACTTTTGCTTCGATATATCCAAT
GATTACTACCATGAAAATATCAAAATTAGTGAAATCTATAAAGAACTATTAAAATTAAGATTAAAAAACT
TCATAATATCTTTTTACACCTTATCTGAGCATACTAGAAGCTATAATAATGCAATTGATAAAAAATCAAT
ATTTAAATTAACTTCTGATGCGGATACAAATCATAAAGCTGAAGAGGAAATATTATCAAAAATTCTTAGC
TCTAAAGATGATGTTAATAATAAATACAATAATGTTAAGATATTAAATCAAATAAGAAGGTGGCTAAAAA
ACATCCACCCTCAATTAAAATCCATAAATAAAGAAACATTCTTTAATTTTGGGCTAAACACACCAGATAA
TATCATAGCCAAGAAAGATACAATATTTTTTAGCAGCTCTCCAAAAAGTATTATCATAAACTTAATATCT
TTGTTATTTAGTTTTATATTTATCGTTAATATTTTTCAAGAAATTAACATTAAAGAAAAATTCTCTATAC
AAGAGCTTAATCAACTACATGAAAGCGACTCTAATAAAATAATAGAAGAAACTAGAAAAAAAATTGATGA
GGCTATACTTCTAGATATCCTATATCCGAAATCGATAAAATATCATTTCATATACGAACAATATGCTGAT
ACTCTCCTAAAGAATGTAATCTTACCAAAATATAATGATACATATGACTTATCAATGATTACATCATTTT
TAATATTTTTTGAGTATTTGGATAACAAAATTATTAACCAACATACGAATAGAATACTTAAAATAATAAG
CAGTATCACCAACCTATCTGAAAAGCAGCTAGATATCGTGATCAAGTATACGACCCCAAGTATAAGAACT
GAAATGATTAAGTCAGCCATCAACAGAGCAAATAAACTTTATACAAATCGTTTAATAGTTGTAGGTGAAG
ACTCCGAAAGTTACTTAAGTACTAAAGGATTTAATGCTGAATACTTAGGGATTTCAAATACTAAAAGAGC
GAAGGTCATAAATAATATTTATATACAATACCTATATAAATGTGCTACAGATAATGCAATTTTAGATTTA
AACGATAACTACATAATACCAATAGAAGTAAATAATATCTTCAAGATGTATCAAGAGCAATTTGACACAT
CCTCTAAAAAGCTATGTAACTCATCATATATTAACTCTATTACAAAGAGCGTTTCTTTGATACTTAATCA
AGAGGAAAATAAAAGAAAATTTGAAAGCTTCAGTGATATGCTAGACCATATCTATTATTTAGTAAAATCA
TTAGAAAAAAATGCTAAAGATGTCGCAGATGATGGTAAAAAACAAACTAGCTCGATAACAGTATCGCTTA
TAAATTACGTTATAAATAGTGTTGTCAACCCTACTTATAATAAAAATGAGCTCCCACTAATAAGTCCAGT
AAGTAAAAACCTATATATGGAGTTTGCTCCTAATTTCTATAGTAAAAGAATACTTATCTCTCCAATATAC
TCAAAAGAATATATTAAAGATAATATAGATCCTACAAATAAAAAGTTTAATAGACTCATCAATAATCTAA
AGGATAACTTCAATATAGAACCCGACTTTATGATTGCTATCTATAAAAGTTCTATAAATAACTACATTGA
GAAATATATAGGATCCTATAATAAGATGATTGATAGCCTTAATAATGACTCTGAATTTAACAAAAATATA
TCTAACAAGGGTGCTCTTAAATTATATTTGCTAGCAATGTCATCAAAGGATTCTTCCTTTAATAGCCTAA
TAGAGTTTTATAGCACTAATACAGACCTAATAACTAATGAATCCGAAACCAATTCATCTAAAAAGATAAA
TAAGCTTCAACATTTTTATGGAGAAATAACTAAATTAAACAAACAAAACAATACTAATGATCAAAATGAT
AAGTCATTGTGGGCGCCTATAGATAACTACTTTAAAGAAAACGATAAATATCTTGAGTCTAAGAGTTATG
CCGACTATAAAAACATATTTAAACAGTTAAATAATCTAATAATAGAACAAGGCTATTCAAGTACATATAA
AAATATCAAACAAGGATATGAACCACTACAAAAAGTTTACTCTGAACTTTCTAAGATAAATAATCATCAA
GGTAATAATAACTTATATAAACTGTTGAAGAAACATCTAGATATTGCCATTAATACTATAAAAACTATCG
CCATACAAGATGCTATAACTAAACTTGATAATACTGTCAATATTGAGTACGAATACATAAATAATCAATT
CCCTTTTAATAAGGATAGTAACTCGGCTGCAACAAATGAAGCTATAACCAAAGACTTTGATAACAATGGT
TATATATACTCTGGATTTATAGAGCAACTATCTCCACTACTTTCTTATAATAAAACTGATGATAGATGGG
AAAGTAAAGATTTTTCAAAACCTGAGGAAATAGACTATCTAAATAAATTCAATAAGGTATATCTTTTAAA
TAAGCTACTATGGGATGATAAAAGAAATCCAAAAGCTATAAAATTTGATATAACTCCTATACCAAACAAA
GATAATGATTATACATTTTTTAGCATAATCCTCGATAAGCAAAACTATGTAAACTCATTAAACATAAAAT
ATTCAGATAGTATTGAAGTTTTGTACAACTGGAATTCACTTGAGTCAACAACTATTACCATAAAATTTGA
GGATGGTAGTAATGAGCAAATAAGCTATCAAGGAAAATGGTCTATATTAAAAGCAATTAAAGACGCAAAT
TGTGATCAAAACAATATTTGTACCTGGGTAATCAAGCACAAAGGTAAAAAATATCCTTTAAGCTTCAAAA
TAGAATCAAAATTCTTACAAGTATTAGGATGGCAAAAACAAGGAGAAGTCAATGTACAATAA
 Primer design