SecReT6
Protein ID: 379717938
SecReT6 ID770
T6SS typeii
Gene symbol-
Locus tagFTU_1707
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1855657..1857387 [+]
ProductDNA polymerase I
NoteIglF
UniProt IDH6LWE9
KEGG IDftg:FTU_1373, ftg:FTU_1707
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 576 a.a.     [Download]
>gi|379717938|ref|YP_005306274.1| DNA polymerase I [Francisella tularensis subsp. tularensis TIGB03]
MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKADIYNLTYVIEDVRYSTNLIL
SDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNLKVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLD
YINNHSISAYDDSLVKLYVKTIQNPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAY
LIRNGLYKTDRLLASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIDFIDLQ
IFAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKSISNIMFDEETLYKKIHIKNQLYKNLFLNN
HNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVSNNLKLIYPFLEFEKYFNQVTLEVSKKSQF
NQEKLEKNILNIIRIYPLLNQNYQLLKDMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIRTLTSND
HKDINIHKSLAKLNKNICNAKHKNAAETAKELTIVLLSKSYYMNPTLIGVYNLPPISNSFFLVLKEITNN
PIIDSIKSKQEAYWKI
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1855657-1857387 Francisella tularensis TIGB03 chromosome, complete genome
ATGAATAATAATATTGATAAATGGTTTGAGAATTTATTTAGCAATATCCATTTATATTATAAACAAGAGC
AATCTTATAAAATAAGTAAGCTTAATGAGTGCATCACTAACGTAATCAAATTTATAAATATAAAAGATTA
TAGAAAAGCTGACATCTATAATCTGACCTATGTTATTGAAGATGTAAGATACTCAACGAATCTAATTTTA
TCTGACTCTGCAATTAAATTTAATGATTTAATATTAAAAAAATTAGATAACCTCTTAGATTGTACTGACA
TTAACTATTTTACTAGCCTTATGAAGAATTTAAAGGTTCTTTTAGAAAAGTATAAACTAGTAATAGAGAA
AGATATATCGAATAGAATAGAACTTATAAAAACTAAGCAGATCGATAAACTAGAATCTATATTTTTAGAC
TATATAAACAACCATAGTATCAGCGCTTATGATGATAGTCTTGTAAAATTATATGTAAAAACTATACAAA
ATCCCAATTCCATTGAGGCTATAGATGAGTATAAATCATATTTCGATACGCTCAAAATATTTATAAAAGA
TCATAAAAATATAGTTAGTTTTATTCCCTTTAGAAAAAATCCTATTTTAAGCTTATTGAAATTAGCTTAT
TTAATTAGAAATGGTTTATATAAAACAGATCGTCTTTTAGCTAGCGATATTATTCTTTTAAGAGCTTTAT
ATTCTATAAATAAAGATACATATAAATTAAGTCTTATAAATGAAAAAACAGATACTAACCTATCAATAGT
TTCGCTGACGTCACTACAAGCTAAGCCCTCAGAAAACTTAAAAAAAACTATTGATTTTATAGATTTACAG
ATATTTGCTATATCTCAGTATTTTGATGATTTCCCTTTACAGGATATTTTTTTTCAAAAAAAATCACAAA
TAGACATTTTCAAGTCAGAATCACTAGAACAACTTATTTTCAGTTTAAAAAGTATTTCAAATATAATGTT
TGATGAAGAAACACTATATAAAAAAATCCATATAAAAAATCAACTCTACAAAAACCTTTTTTTAAATAAT
CACAATAGTTTGATAGAAGATATTATAGAAAAATCTCCAGCAAACTTATTAACAAAGCTAGCTAATAAAT
ACTTCCAAATACTGCTAGACATAGCAACAATAATAAATATTCAATTAGTAAGTAATAATTTAAAGCTTAT
TTATCCTTTCTTAGAGTTTGAAAAATATTTTAATCAAGTAACTTTAGAAGTATCAAAAAAATCACAGTTT
AATCAAGAAAAGCTAGAAAAGAATATTCTAAATATTATCAGGATATATCCTTTACTAAATCAAAACTACC
AATTATTAAAGGATATGGAACAAAAAATTATTGATGATAAAAATAGTATAGAATCAAACGATATATATAA
GCTTAGTGTTTTTGTAAATAGCAAAAGTTTTTCTACCTATAAAGAAATCAGAACCTTAACCTCAAATGAC
CATAAAGATATTAACATCCACAAATCTTTAGCAAAACTGAACAAAAATATTTGTAATGCCAAACATAAGA
ATGCCGCTGAAACAGCTAAAGAGCTAACGATAGTTCTTTTAAGTAAATCTTACTATATGAATCCAACTTT
GATAGGAGTATATAATCTACCGCCAATTTCAAATAGTTTTTTTTTGGTGCTTAAAGAGATTACAAATAAT
CCGATCATTGATAGTATAAAAAGCAAGCAAGAAGCTTATTGGAAAATTTAA
 Primer design