SecReT6
Protein ID: 379717940
SecReT6 ID770
T6SS typeii
Gene symbol-
Locus tagFTU_1709
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1857922..1859352 [+]
Producthypothetical protein
NoteIglH
UniProt IDH6LTE8
KEGG IDftg:FTU_1375, ftg:FTU_1709
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|379717940|ref|YP_005306276.1| hypothetical protein FTU_1709 [Francisella tularensis subsp. tularensis TIGB03]
MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNALLFKYYSNLYYFIPKSCLLEISDKGHNGY
YIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRDITTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCK
EDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNVQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLF
KYKNNDLNKIDFFLEVKTENHNDEKLSSLFRVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAI
EVLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDLIEI
NSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTLLAIAKLLKINTNDLTLLSMLL
QDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKFINQNTFSFIKKIVLNNSI
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1857922-1859352 Francisella tularensis TIGB03 chromosome, complete genome
ATGGATGAAAAAAGAAAAGATTTAAGTACGAATGATGCTAGCATCCTAAAAAAAACTTTTGACAAACTAA
GTAATGATATAAGAGATGATTTTGATAAGAGAATTTTTGATTATAGTAATGCTCTTTTATTCAAGTATTA
TAGTAACCTTTATTATTTCATTCCTAAATCATGCTTATTAGAAATAAGTGATAAAGGACACAATGGTTAC
TATATTCCGCCTCAGGAATATTTTTTCATAGAAGACAAGAGAACAGGTAAAACTCTAACATATACGACAA
AGTCAGAAAATATAATACTCCCTATTAGAGATATCACAACCATAAAACAAAGTGATACATCAATAAATAT
ATCATTGGAATTTGCAAATAACTTTGACTATGATTATGTTACTATCTGGATAGATCCAACTTTATGTAAA
GAAGATCCTAGCTTTGCCACATACATATTTAACCAAGTATTAGAAGATAATGGCTCAGCAAAGATTAAAT
TTTCAAATCATAGTTATACAACAAAAAATGTACAAATAGAACCAATTAAGTTCCAATTAAAACCAACAGA
AAAATTAGTTCTCAATATCCATTCTCCTAGCCTTTTATATGGTTTTAACATAAAGATCAAAGACTTATTT
AAATACAAAAATAATGACCTCAACAAAATTGACTTTTTTTTAGAAGTTAAAACTGAAAACCATAATGACG
AAAAATTATCATCTCTATTTAGAGTTAATTTAATACCTGTGTTTAATAGTTTTGATGATTACTCAAGCAC
CTCATTTGCTTCGATGAATCTCTCAGAGAGTAAACTAAAACATCATCAAAAAGATGATGCTCAAGCAATA
GAAGTATTATCTGTTTATGAGAATAATAAACAATGTGATTTTAATAGTTTTCTTTTTGTAGGACAGAATG
AGTATTATTTTAATCGCAGCACACAATCTTTAAATTATAGTAGCGTACTCCCTCAATTTAGTAATAAAAT
AATAGGAACAAAAATACATACATATACAACCTGGACACAGATAACTGAGATTTCTGATCTAATTGAAATT
AACTCAAATGCAATAGCATCTATAAGCTGTAATATTTCTCCAATAGTTATTAACAAAGCACTAAACAACT
ACAATAGCAATGCTAAAGAAATGTTTAATATAATAGATATGATCATCTCTAAGAATATGTATTCAAAAAC
AACACTCCTAGCTATAGCAAAGCTTTTAAAGATTAATACTAATGACTTAACTTTACTTTCAATGCTCCTA
CAAGATGTTGAGATGGACTCTACTATAAATGAGCTAATTTTAACCTTAAGTGATAAATATAACCCAAAAT
ATAAACATTTCTTAAATTTTCATATTGGTATTATATGCAAATTTATAAATCAAAACACCTTTAGCTTTAT
TAAAAAGATTGTTTTAAATAACTCTATATAA
 Primer design