SecReT6
Protein ID: 379717941
SecReT6 ID770
T6SS typeii
Gene symbol-
Locus tagFTU_1710
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1859365..1859988 [+]
Producthypothetical protein
NoteDotU
UniProt IDH6LTE9
KEGG IDftg:FTU_1376, ftg:FTU_1710
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-10, Aligned region: 28..205
Protein Sequence: 207 a.a.     [Download]
>gi|379717941|ref|YP_005306277.1| hypothetical protein FTU_1710 [Francisella tularensis subsp. tularensis TIGB03]
MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVD
EKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEICYQTISLILHNDFYGKYYDNI
YNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW
 
Nucleotide Sequence: 624 bp     [Download]
>gi|379716390|ref|NC_016933.1|:1859365-1859988 Francisella tularensis TIGB03 chromosome, complete genome
ATGAAAGACTTTAAAGAGATAGAAATTATTCTAGATATTATAAAAACTACAAGAGAAATTATAGAAGATA
ATGATAATGATAATGAGAAAATATCATACCATCGTAATAATATAAGAAAAAGTATTTTCTTCCTACAAGA
AGAGCTCTTAGAAAAATATAGTGAAACTGTCTGTAAATATATAGTTTTTCCGTTACTTGCATATGTTGAT
GAAAAATTGATGCTACTTAGGGAAAAGTCAGCAAGCAATATTTCTTGGAGTCTACTACAATTAGAATATT
ATGATAGAAAAGATGGCGGTGAATATGTTTTTGAGATAACTGATAATATTTTATCAGAGAATATCTATCC
AGAAATTTGCTACCAGACAATATCACTTATCCTACACAATGACTTCTATGGCAAATACTATGACAATATA
TATAACCATAGCTTTCTTGCTTATAAGAAAGAAATTGATAAGCATATAGAAAATTCGACAATTGATTCGG
TTAATTTTATTGATATACCCGTTAATAGCCCCCCACTGTCAAGAAAATATAGTAAGACGCTTAAATTCTT
ATTAAGAATAGGCGTTCCTTTAGGACTGTTTCTTTTAAGCTTACTAATTTTATTAAGCTGGTAA
 Primer design