SecReT6
Protein ID: 379717947
SecReT6 ID770
T6SS typeii
Gene symboliglC2
Locus tagFTU_1716
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1867743..1868372 [-]
ProductIntracellular growth locus subunit C
NoteIglC
UniProt IDH6LTF5
KEGG IDftg:FTU_1382, ftg:FTU_1716
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 2.10E-141, Aligned region: 1..209
Protein Sequence: 209 a.a.     [Download]
>gi|379717947|ref|YP_005306283.1| Intracellular growth locus subunit C [Francisella tularensis subsp. tularensis TIGB03]
MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAAAS
VIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMID
LSNLELYPISAKAFSISIEPTELMGVSKDGMRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA
 
Nucleotide Sequence: 630 bp     [Download]
>gi|379716390|ref|NC_016933.1|:c1868372-1867743 Francisella tularensis TIGB03 chromosome, complete genome
ATGAGTGAGATGATAACAAGACAACAGGTAACAAGTGGCGAGACCATTCATGTGAGAACTGATCCTACTG
CATGTATAGGATCTCATCCTAATTGTAGATTATTTATTGATTCTTTAACTATAGCTGGGGAGAAACTTGA
TAAAAATATCGTTGCTATAGATGGTGGAGAGGATGTCACGAAAGCTGATTCGGCTACAGCTGCTGCTAGT
GTAATACGTTTATCTATAACGCCAGGCTCTATAAATCCAACAATAAGTATTACTCTTGGTGTTCTAATTA
AATCAAATGTTAGAACTAAAATTGAAGAGAAAGTTTCGAGTATATTACAAGCAAGTGCTACAGATATGAA
AATTAAGTTAGGTAATTCTAATAAAAAACAAGAGTATAAAACTGATGAAGCATGGGGTATTATGATAGAT
CTATCTAATTTAGAGTTATATCCAATAAGTGCTAAGGCTTTTAGTATTAGTATAGAGCCAACAGAACTTA
TGGGTGTTTCAAAAGATGGAATGAGATATCATATTATATCTATAGATGGTCTTACAACATCTCAAGGAAG
TTTGCCAGTATGTTGCGCAGCTAGCACAGATAAAGGAGTTGCTAAAATAGGATATATTGCAGCTGCATAG
 Primer design