SecReT6
Protein ID: 379717948
SecReT6 ID770
T6SS typeii
Gene symboliglB2
Locus tagFTU_1717
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1868389..1869909 [-]
Producthypothetical protein
NoteIglB
UniProt IDH6LWF9
KEGG IDftg:FTU_1383, ftg:FTU_1717
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-144, Aligned region: 73..497
Protein Sequence: 506 a.a.     [Download]
>gi|379717948|ref|YP_005306284.1| hypothetical protein FTU_1717 [Francisella tularensis subsp. tularensis TIGB03]
MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLANNDNINNYNQ
KYIQKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYD
ISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDL
SEITHIKSFEALLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKN
ESYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLFADYMELSL
ANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCVIRDKIGSI
VDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVETIPGKPGWYSCKINVIPHIQFEGMNTTM
TIDTRLEPELFGTNNN
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|379716390|ref|NC_016933.1|:c1869909-1868389 Francisella tularensis TIGB03 chromosome, complete genome
ATGACAATAAATAAATTAAGTCTCACTGATGAACTTTTAAATAATTTTGGGGGATCTACAGAAGTTGATA
GTGTACTCAAAAATATAGATTTTGATGTTTCAGATGATGCTTCTAAAGTTTTATCTTTATCTACTGACTA
CAATGCTAGAAACCTTATGGCGCTATCTTTGGTATTAGCAAATAATGATAATATAAATAATTATAATCAA
AAATATATCCAGAAAGTTATTACAGTTATTGATAAGCTTATTGATTTACAAGTTAATTCTATTATATCTA
ATGATGAGTTTAGAGCACTTGAGCAAGAATGGCTAAAGGTGCAAGAGGTTTGTCAAGAAGACTATGATAA
TGTTGAAGTAAGTATATTAGATGTAAAAAAAGAAGAGCTACAATATGATTTCGAGAGAAATTTATATGAT
ATATCTAGTAGTGACTTTTTCAAAAAAGTTTACGTTTCAGAATTTGATCAATATGGTGGCGAACCTTATG
GCGCAATATTAGGATTGTATAATTTTGAAAATACCACAAATGATATAATTTGGTTGACTGGAATGGGTAT
GGTGGCAAAGAATTCTCATGCACCATTTATTGCATCAATTGATAAGTCATTCTTTGGTGTTAAGGATTTA
TCAGAAATCACTCATATAAAAAGTTTTGAAGCTTTGCTTGAGCATCCTAGATATAAAGAGTGGAATGATT
TTAGAAACCTTGATGTTGCTGCATATATAGGTTTGACCGTAGGTGATTTTATGTTGCGGCAACCATATAA
TCCTGAGAATAATCCAGTTCAGTATAAACTTATGGAAGGCTTTAATGAGTTTGTTGATTATGATAAGAAT
GAAAGTTATCTATGGGGACCTGCTTCAATTCATCTAGTTAAGAATATGATGAGATCTTATGATAAAACTA
GATGGTTCCAATATATAAGAGGAGTTGAGAGTGGTGGTTATGTAAAGAACTTGGTAGCTTGCGTATATGA
TAATAAAGGCATTCTAGAAACTAAGTCACCTTTAAATGTATTATTCGCTGATTATATGGAGTTATCACTT
GCAAATATTGGTTTAATACCATTTGTAAGTGAAAAAGGTACTAGTAACGCTTGTTTCTTTAGTGTAAATT
CTGCTAAAAAAGTCGAAGAATTTGTAGATGGATTTGACTCAGCAAACTCAAGATTAATTGCTAACCTTTC
TTACACTATGTGTATATCGAGAATATCTCATTATATTAAATGTGTAATTAGAGATAAGATTGGTAGTATT
GTGGATGTCGAGTCGATTCAAAAAATTCTTTCTGATTGGATATCAGAATTTGTCACCACAGTCTATCAAC
CAACCCCTTTAGAAATGGCGAGATATCCTTTCAGAAACGTTTCTATCGAGGTTGAAACCATACCGGGTAA
GCCTGGCTGGTATTCATGCAAAATAAATGTAATTCCCCACATTCAATTTGAAGGAATGAATACTACAATG
ACTATAGATACTAGGCTTGAACCAGAATTATTCGGTACAAATAATAACTAA
 Primer design