SecReT6
Protein ID: 379717949
SecReT6 ID770
T6SS typeii
Gene symboliglA2
Locus tagFTU_1718
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1869923..1870477 [-]
Producthypothetical protein
NoteIglA
UniProt IDH6LTF7
KEGG IDftg:FTU_1384, ftg:FTU_1718
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-43, Aligned region: 4..156
Protein Sequence: 184 a.a.     [Download]
>gi|379717949|ref|YP_005306285.1| hypothetical protein FTU_1718 [Francisella tularensis subsp. tularensis TIGB03]
MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFADREVRRVNNGVDRVLEEMN
ISFDFEAPNFVSKDRSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTID
MIFSDSNELESLKSKIPALTNYTIKDSCDAAESQDLSNQQVDGK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|379716390|ref|NC_016933.1|:c1870477-1869923 Francisella tularensis TIGB03 chromosome, complete genome
ATGGCAAAAAATAAAATCCCAAATTCAAGGTTGATGATAAATTATGAAACTAATGTTGATGGTGTCTTAA
AGAAAAAAGAGCTACCTTACAGAGTCCTAGTTGTTGGCGATTTATCAAAAGGAAGATCTGTGGATGCAAA
AAAAGAGTTCGCAGATAGAGAGGTCAGAAGAGTAAATAATGGTGTTGATAGGGTTTTAGAAGAGATGAAT
ATATCTTTTGATTTTGAGGCACCAAACTTTGTTTCTAAAGATCGTAGTAATTTAAAAGTTAATTATAGAA
TTGAAAGTGTCAAAGATTTTAGACCTGATGCTGTTGCTAAAAAAGTTCCTGAAATCAGAGCGCTGCTTGA
AATGAAAGAGATATTAGCATCCTTTGCTAAGGACATTGAAAATAATCGTAATCTCAAGAAAACCATAGAT
ATGATTTTTTCAGATAGTAACGAATTAGAATCATTAAAGAGTAAGATTCCTGCTTTGACAAACTATACGA
TTAAAGACTCTTGTGATGCTGCTGAGTCTCAAGACTTAAGTAATCAACAAGTAGATGGTAAGTAG
 Primer design