SecReT6
Protein ID: 379717950
SecReT6 ID770
T6SS typeii
Gene symbolpdpD2
Locus tagFTU_1719
StrainFrancisella tularensis TIGB03
Repliconchromosome [GenBank: NC_016933] [Browse all T6SS(s) in this replicon]
Location [Strand]1870558..1874145 [-]
ProductPathogenicity determinant protein D
NotePdpD
UniProt IDH6LTF8
KEGG IDftg:FTU_1385, ftg:FTU_1719
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1195 a.a.     [Download]
>gi|379717950|ref|YP_005306286.1| Pathogenicity determinant protein D [Francisella tularensis subsp. tularensis TIGB03]
MDQDINDLLYDTNDLKKEKVCGGFFDFIKAWFYNDVERHMFFEDEIIVAQKLKTMDVMANTYALERKKYF
EKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLWSSITDTDVYSFFIKSSVNQVLGGGNIAQLTSLPKFK
FNAIASVNNENISAAANLAATGAKSFFGSSCINIWSNLPVFDSERGDVKSFIPLYLRISGKASSALFNYN
IDISASTNRLKFTESKCMELLNNFKGNVNLRLVAAKSSREAKSFIYTPKFKEDSNKHLNDLGFILNTQQG
SYRYLVPEIRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLRVSSKDYENPL
IQVKTSVNVTSFDLLSGQIKGKILADDLIGFSDAKGAINKFRNEVDTIIKNNISESFKSPFKIPNLSEFS
DMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQTSGSYNTKSGMGYSMAQRHQLKEAIPYNEGLLE
NSAQQDFDLVKPTGNSTLGAVQDNLSNIYDKSSTFDSVIGSLRELYKLKGEDLTNIDSHDILNVLSQNSS
LSGLSSSIAADLNELNSKFKDITSINKKTSEAILSTNYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTL
KKEEFRDQMSTINIIEFGSDGDLPILFNLCKMMTSESAKDGAKNFLSQKENVNKTKEFFDALENTTSVIS
PESNISYTSINVLCSKNAGGVITENNKASSVSLGSTISLADFNRMYSLDSRVSVLGVSPLEELSSFSAKK
NEYKITFEEYFTKLAIQRYMEVIMIDDEADFIKSFVLPMMECQKKLLDNLVILNKDAKWKSSSSFKRAFS
NRGSFSFTGWLKERLPGFDFELSQEYAYFTGLVINFAFEEDNSSSETVIKLCKIIKSLDRLVRGFYFLLR
RMVKNRNTKVGSHNVSESHINMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCAS
ICIPTSAFFTLVNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRDGKV
KRVTSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVE
FNKDQQSLLYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRKYR
PMIWV
 
Nucleotide Sequence: 3588 bp     [Download]
>gi|379716390|ref|NC_016933.1|:c1874145-1870558 Francisella tularensis TIGB03 chromosome, complete genome
ATGGATCAAGATATCAACGATTTATTATATGATACTAATGATTTGAAAAAAGAAAAAGTATGTGGCGGCT
TTTTTGATTTTATCAAAGCTTGGTTTTATAATGACGTTGAAAGACATATGTTTTTTGAAGATGAGATTAT
TGTGGCTCAGAAACTTAAAACGATGGATGTCATGGCTAATACATACGCCTTAGAGAGAAAAAAATATTTT
GAAAAATTTCTCAAAGATTCTCATAAACAAAAAGGTTTTTTTACAAGAATAAAAGATAGAGATTTTGCTT
TTTATAAAGATCCTACTAGGGTTAAACTATGGAGTAGTATTACTGATACTGATGTCTATAGCTTTTTTAT
AAAGTCAAGCGTTAACCAAGTGCTTGGTGGTGGTAATATAGCTCAACTGACATCATTACCAAAATTTAAG
TTTAATGCAATAGCATCAGTTAATAATGAAAACATCTCGGCAGCAGCTAATCTTGCAGCTACTGGAGCAA
AAAGTTTTTTTGGAAGTTCATGTATAAATATTTGGTCTAATTTACCTGTATTTGATAGTGAAAGAGGAGA
TGTTAAATCATTTATTCCATTATACCTAAGAATAAGTGGTAAAGCTTCATCGGCATTATTTAATTATAAT
ATAGATATAAGTGCTAGCACAAATAGATTAAAATTTACTGAATCAAAATGCATGGAATTATTAAATAACT
TTAAGGGCAATGTAAATCTTAGATTAGTGGCTGCAAAAAGCTCTAGAGAAGCAAAAAGCTTTATTTATAC
TCCAAAATTTAAAGAAGATAGTAATAAGCATTTAAATGATTTAGGTTTTATTCTAAATACTCAGCAAGGT
TCATATAGATATTTAGTTCCTGAAATTAGGGATGGACTTGATCTAATTAGAGAATATACATACCCCGAAA
TTGAACAGATTTATTTTGGTAGGAGTGCACTTTCTGGTTATTCAAAAAGTAATTATGACAAGCAAAGTTT
AGGTATTGAGAAAAATGGTGAGGGTCTTATGACTCTTAGGGTTAGTTCCAAAGATTATGAAAATCCACTA
ATTCAGGTCAAAACATCAGTTAATGTAACTAGTTTTGATCTTTTATCAGGACAAATAAAAGGTAAGATTT
TAGCTGATGACTTAATTGGTTTTTCAGATGCTAAAGGTGCTATTAATAAGTTCAGAAACGAAGTTGATAC
AATTATTAAAAACAATATTAGTGAAAGCTTTAAGTCTCCTTTTAAGATACCAAACTTATCTGAATTTAGT
GATATGGAGATAAGAGTGAGGTTTGGCTTATATTCTAAACAATCAGCATCCAAGTTGAGGACCATAAGAA
TCTCTATTCCTATGACTACTAAAATGTTAGATTTTAATCAAACATCTGGGTCATATAATACAAAATCAGG
TATGGGTTATTCAATGGCTCAGAGACATCAATTAAAAGAAGCAATACCTTATAATGAAGGTCTTCTAGAA
AATTCTGCTCAGCAGGATTTTGATTTGGTTAAACCAACCGGAAATAGTACTCTTGGAGCTGTGCAAGATA
ATTTATCAAACATATATGATAAAAGTAGTACGTTTGACTCAGTAATAGGTTCTTTGAGAGAGCTTTATAA
ACTTAAAGGTGAAGACCTAACAAATATTGATTCTCATGATATCCTTAATGTTTTATCACAAAACTCGTCT
TTATCAGGGTTATCTAGTAGTATCGCAGCAGATCTAAATGAGTTAAACTCTAAGTTTAAGGATATTACGT
CTATAAATAAAAAAACATCTGAAGCGATATTATCTACGAATTACCAGCAATATAATCCTAGTTTTAATAA
AGCAAAAATATTCGATAATCCAGATTCTTTCTATGTTCAAGATACTTTAATTAACTACTCACAAACCCTA
AAAAAAGAAGAATTTAGAGATCAGATGTCAACAATAAATATTATTGAATTTGGTAGTGATGGTGACTTAC
CTATATTATTTAATCTTTGTAAAATGATGACTAGCGAGTCAGCAAAAGATGGCGCAAAAAATTTTCTAAG
TCAAAAGGAGAATGTTAATAAGACTAAAGAGTTTTTTGATGCTCTAGAAAATACCACTTCTGTAATAAGT
CCAGAATCAAATATCAGTTATACATCTATTAATGTGCTTTGTAGCAAAAATGCTGGAGGTGTAATTACTG
AGAATAACAAAGCATCTTCTGTATCCCTAGGTTCAACTATTAGTTTAGCGGATTTTAATAGAATGTATTC
GCTTGACTCAAGAGTTTCTGTGCTTGGAGTATCTCCTTTAGAAGAGTTATCAAGTTTTTCAGCGAAAAAA
AATGAATATAAAATCACTTTTGAAGAATATTTTACTAAGTTAGCGATTCAAAGATATATGGAAGTTATTA
TGATAGATGATGAAGCTGACTTTATAAAATCATTTGTATTACCAATGATGGAGTGTCAAAAGAAACTATT
AGATAATTTAGTTATTCTAAATAAGGATGCTAAATGGAAAAGTAGTTCATCATTTAAGAGAGCTTTCTCA
AATAGAGGTAGTTTTAGTTTTACTGGTTGGCTTAAAGAGAGACTTCCTGGCTTTGATTTTGAGCTTTCTC
AGGAGTATGCTTATTTTACTGGCTTAGTAATAAACTTTGCCTTTGAAGAAGATAACTCTTCTTCTGAAAC
TGTAATTAAACTATGTAAAATTATAAAATCTTTAGATAGGCTTGTTCGAGGTTTTTATTTCTTACTAAGA
AGGATGGTGAAAAATAGAAATACTAAAGTTGGTTCTCATAATGTCTCTGAAAGTCACATTAATATGGTTA
AGCAGATTTTAACATCCTTATGTGAACCATATCAGATTTTAACTCAGAAGGTAAGCGATAATGCTGAACT
GTTGTCTGCTTTAGTTAATATGTTGAGTTTTATGGATAGCCTTGTTGAAGTACAGCGGCTATGTGCTTCG
ATTTGTATTCCAACCAGTGCATTTTTCACTTTAGTGAATGAAAATAAAAATTTGTTGAAAGATATTTGCT
ACACTGTCGAAAAAAGTGGTGTTACAGGAATAGTGGTTGAATCGACATTTAGCTATTCGCCAGAACTCTT
CAAAGAAAATCAACAAGATATTAAGCTTAACATTAAAAACACGTCAGTCAGAGTACGAGATGGTAAAGTC
AAGAGGGTTACCAGCATTGATAGGAATGCTAATACTGAAGCTATCTTACAAAGTATTTATGATAATATAA
TTGCGTTTGATGAACAAGATTTAGAAAGACTATTTACGGGGTTTAGGATTTTAAAACAAGAAAATTCGAC
AAACACTAATAAAGCCGTTTTCAATATTGGTTTAACATATCATCCAATAACTAATAATGCTTTTGTTGAA
TTTAATAAGGATCAACAAAGTTTATTGTACTCATATAATAATTTAAGCAAAGATGCGTATGTTACAAAAA
TTAAAAGTATAGTTGATGCTAAAGTTGCTTTAAACCTTAGTTTTGAACATGAAGAGATTAGAAGTTCACA
AGGTTTTAGTGTCTTAGCAACTGTACCAGCTAGAGGATATTCTATAGATGATTTAAATAGAAAGTATAGA
CCAATGATCTGGGTTTAA
 Primer design