SecReT6
Protein ID: 379743551
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_13963
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]115130..115414 [+]
Producthypothetical protein
NotePAAR
UniProt IDH8JZI4
KEGG IDvci:O3Y_13963
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 9.60E-19, Aligned region: 19..85
DUF4150 [PF13665], Evalue: 0.00012, Aligned region: 22..43
DUF4150 [PF13665], Evalue: 0.00012, Aligned region: 59..79
Protein Sequence: 94 a.a.     [Download]
>gi|379743551|ref|YP_005334603.1| hypothetical protein O3Y_13963 [Vibrio cholerae IEC224]
MGNGIVVGHLGTDHDGFPPTPVTAGSATVRYDGIPAARLGDPLAPHDKPKHPSHGRAIAAGSGTVMIDGK
PAARVGDAVDCGGVLQGASSVNIG
 
Nucleotide Sequence: 285 bp     [Download]
>gi|379743460|ref|NC_016945.1|:115130-115414 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGGGTAACGGAATCGTAGTAGGGCATTTAGGTACAGATCATGATGGTTTCCCGCCAACGCCAGTGACCG
CAGGCTCAGCAACTGTGCGTTATGATGGGATTCCAGCTGCTCGGCTTGGGGACCCCTTGGCCCCTCACGA
TAAACCAAAGCATCCCTCGCATGGCCGAGCGATTGCTGCGGGTTCTGGGACGGTGATGATTGATGGAAAA
CCCGCAGCAAGGGTTGGAGATGCGGTCGATTGTGGTGGCGTATTACAGGGAGCAAGCAGTGTCAACATTG
GTTAA
 Primer design