SecReT6
Protein ID: 379743554
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_13978
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]117384..118859 [+]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDH8JZI7
KEGG IDvci:O3Y_13978
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|379743554|ref|YP_005334606.1| type VI secretion system protein ImpC [Vibrio cholerae IEC224]
MSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVNKSLVDQMLVE
LDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTKDELLEDFEFAPETAQSGLYK
HVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIKD
LKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFAF
ATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMRK
GSDNAAFFSANSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLER
ELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRLDQ
A
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|379743460|ref|NC_016945.1|:117384-118859 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGTCTACGACTGAAAAGGTATTGGAAAGGCCACAGCTTGCTCAAGGCAGCCTTCTTGATGAAATTATGG
CGCAAACCCGTATCGCACCAAGCGAAGAGGGTTACGACATCGCGAAAAAAGGTGTTGCAGCGTTTATCGA
AAATCTTATGGGTTCACAACACTCTGCTGAGCCTGTCAACAAATCTCTGGTTGACCAAATGTTGGTTGAA
CTGGATAAAAAAATCAGTGCACAGATGGATGAAATCCTGCACAACTCACAATTCCAAGCGATGGAATCGG
CGTGGCGCGGTTTGAAGCTGTTCGTGGATCGCACTGATTTTCGTGAAAATAACAAAGTCGAAATCCTTCA
CGTAACCAAAGATGAACTGCTGGAAGATTTCGAGTTTGCTCCAGAAACGGCTCAGTCCGGTCTTTACAAG
CACGTTTATTCTGCCGGTTATGGTCAATTTGGTGGCGAACCTGTTGGCGCGATCATTGGTAACTATGCGT
TTACCCCTTCAACGCCAGATATGAAGCTGCTGCAATACATGGGCGCACTGGGTGCCATGGCGCATGCTCC
TTTCATTTCAAGCGTAGGTCCTGAATTCTTTGGTATCGACTCCTTCGAAGAACTGCCTAACATTAAAGAT
CTCAAGTCGACATTTGAAAGCCCGAAATACACCAAATGGCGTTCACTGCGTGAATCGGAAGATGCTCGCT
ATCTTGGTTTGACTGCGCCTCGTTTCCTGCTGCGTGTTCCTTACGATCCAATCGAAAATCCAGTGAAGTC
GTTCAATTATGCGGAAAACGTCAGTGCTTCGCACGAGCACTACCTGTGGGGTAACACGGCATTTGCCTTC
GCAACTCGTTTGACGGATAGCTTTGCTAAATATCGCTGGTGTCCAAACATTATCGGTCCACAAAGTGGTG
GTGCAGTTGAAGATCTGCCGGTGCATGTCTTTGAATCTATGGGTGCATTGCAAAGCAAGATCCCAACCGA
AGTCCTGATCACGGACCGTAAAGAATTTGAACTGGCGGAAGAAGGTTTTATTGCTCTTACTATGCGTAAA
GGCAGTGATAACGCGGCGTTCTTCTCTGCAAACTCCATTCAAAAACCTAAGGTTTTCCCAAATACCAAAG
AAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCATCAACCGTTT
GGCGCACTATGTGAAAGTTCTGCAACGTGAGCAGATCGGTGCTTGGAAAGAGCGTCAAGATCTTGAGCGT
GAACTGAACTCATGGATCAAACAATACGTTGCTGATCAAGAGAACCCACCTGCAGACGTACGTAGCCGTC
GTCCACTTCGTGCTGCGCGCATTGAAGTGATGGATGTGGAAGGCAATCCAGGTTGGTATCAGGTGTCGCT
CTCGGTTCGTCCTCACTTTAAGTACATGGGTGCGAACTTTGAGTTGTCATTAGTTGGACGTCTTGATCAA
GCCTGA
 Primer design