SecReT6
Protein ID: 379743555
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_13983
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]118862..119299 [+]
Producttype VI secretion system protein
NoteTssE
UniProt IDH8JZI8
KEGG IDvci:O3Y_13983
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-20, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|379743555|ref|YP_005334607.1| type VI secretion system protein [Vibrio cholerae IEC224]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSR
KYRVF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|379743460|ref|NC_016945.1|:118862-119299 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGCGTTCTGGTGAGAGCGGATCAAGATAGCTTTAACCCGCTGACTTTAAGGTTCCACAT
TACCGCGACCATCAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGA
AAATATCGAGTGTTTTAA
 Primer design