SecReT6
Protein ID: 379743557
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_13993
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]121038..122054 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDH8JZJ0
KEGG IDvci:O3Y_13993
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-93, Aligned region: 27..325
Protein Sequence: 338 a.a.     [Download]
>gi|379743557|ref|YP_005334609.1| type VI secretion system protein ImpH [Vibrio cholerae IEC224]
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFS
PSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKY
RYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDV
SIRQWVRRRVSIDRSQQLALGKQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLC
KLVEFILREQMAYDLELAMDEREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|379743460|ref|NC_016945.1|:121038-122054 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGGGGCACACAGAGCGGAATGCAGCCGTTGATCTGAATTCAGATCCAGCGCAAGCCTCTCCGTTGAGCT
TGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTGATATCAA
TCCCGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGGATTTTCG
CCCAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGAGCGTTGGGTTATGTTGACCAACTTTTTTGGCC
TTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTGGGGGATA
TAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCGTAAATAC
CGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTGGTGGGGT
TGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGGGCACGCT
GGCCGGACGTAGCCGTTCGCCACAAGTTGTGGCCGGCATTATTGCTCACTGTTTTGATTTACCGGATGTC
TCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGATCGGAGTCAGCAACTGGCGCTGGGCAAGCAGA
ATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGCAGTGGAAAATTTATTATCTG
TATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCCACTTTGC
AAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTATGACCTCGAGCTGGCGATGGATGAACGAGAAG
CGCCGCTGTTTTGTCTGGATACTAGACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCCAAGATGC
AGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA
 Primer design