SecReT6
Protein ID: 379743558
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_13998
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]122057..123544 [+]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDH8JZJ1
KEGG IDvci:O3Y_13998
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-06, Aligned region: 35..102
Protein Sequence: 495 a.a.     [Download]
>gi|379743558|ref|YP_005334610.1| type VI secretion system protein ImpI [Vibrio cholerae IEC224]
MNSVTLPSLTLLVTNAQHLESGLSAQHTWTSSGGVIGSSPNAQWRLVDAQGSVKPMHCEVMMVDGAYCLK
DSCGSTYVNGADMPLGVGQMARLTHKDEVSVGPYRLRVLFGNAIEVEEQYGSLDALFASKDEDLLADLTL
DIEPEKHELPTNTDPLQALDNLMGAAGSSTSLLDDPKSEQPLSAQPSLVPQDNLVLQNADFTPQADSEYE
MTSSIRLKKILGFAKATFAKQTKSEAPNVTSATPTISQYKTSESNVSEGFTMDEKVLDLLEEEVAKSFQP
QLEKSAYSTMHTSSTSQANHLVTGPILEGLGVDLSDENDMNRMHLLSQELGESLQACVRGLLDLHQQVSE
SRFGTLNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKTVRDHNEAMQFATSEALS
QILNAFSPQVMLRRFHHYKRNSDTTQTSTDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDRKIRE
KQLEL
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|379743460|ref|NC_016945.1|:122057-123544 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGAACTCAGTGACATTACCTTCGTTGACCCTATTAGTCACCAATGCTCAGCACTTAGAGTCTGGCTTGT
CCGCTCAGCATACGTGGACCTCGTCAGGTGGGGTGATCGGCTCATCGCCGAATGCGCAGTGGCGTTTGGT
CGATGCGCAAGGCAGTGTAAAACCCATGCACTGTGAAGTGATGATGGTAGACGGGGCGTATTGTTTAAAA
GACAGCTGCGGCAGCACGTATGTCAACGGGGCAGACATGCCACTGGGCGTTGGGCAAATGGCACGTCTGA
CTCACAAAGATGAAGTGAGTGTGGGGCCTTACCGTTTGCGAGTGCTGTTTGGTAACGCCATCGAAGTGGA
AGAACAATATGGATCTTTAGATGCGCTGTTTGCCTCTAAGGATGAGGATCTGCTAGCGGATTTGACGCTC
GACATCGAACCAGAAAAACACGAATTACCAACCAATACAGACCCATTACAGGCGCTCGATAACCTGATGG
GTGCGGCGGGCAGTTCGACCTCCTTACTGGATGATCCTAAAAGTGAGCAGCCGTTATCCGCCCAACCTAG
CCTCGTGCCACAAGATAACTTAGTGCTGCAAAATGCCGATTTTACGCCACAAGCGGACAGTGAGTATGAG
ATGACCTCATCGATCCGCCTTAAGAAAATTCTTGGTTTTGCGAAGGCCACCTTTGCTAAGCAAACCAAAT
CAGAAGCACCGAACGTGACTTCTGCCACCCCCACAATTTCTCAATATAAAACCAGCGAAAGCAACGTATC
AGAGGGCTTCACAATGGATGAAAAAGTACTGGATTTGTTAGAAGAGGAAGTCGCGAAAAGTTTCCAACCG
CAGTTGGAGAAAAGCGCGTATTCCACTATGCACACAAGCTCAACCAGCCAAGCTAACCACTTGGTGACAG
GTCCGATCTTGGAAGGGCTCGGCGTAGATCTGAGCGATGAAAATGATATGAATCGTATGCATCTTTTATC
GCAAGAGTTGGGTGAGTCTTTGCAAGCTTGTGTGCGCGGTTTACTCGATTTGCATCAACAAGTGAGTGAA
AGCCGTTTCGGTACTTTGAACCGTAATCTGCAACCCATTGAAGATAACCCGCTGCGTTTAGGTCTCTCCT
ATGAAGAGACGATCCGCACTCTGTACGATGCCGACAAGAGCGTCGTGCACCTTTCTGCCCCTGCGGCGAT
TGCTGAAAGCCTAAAAACCGTTCGCGATCATAATGAAGCGATGCAGTTCGCCACGTCAGAAGCCTTGAGC
CAAATTCTCAACGCTTTCTCACCACAGGTGATGCTGCGCCGTTTCCACCACTACAAGCGCAATTCTGATA
CCACACAAACTTCAACGGATGCTTGGGCGTGGAATATGTACTGCAGCTACTACCAAGAGCTGACCTCTAA
CCGCCAACGCGGCTTTGAGAAGTTGTTCTGGGAGATCTTTGAGCAAGCCTACGATCGCAAAATTCGCGAG
AAGCAACTGGAGCTATAA
 Primer design