SecReT6
Protein ID: 379743560
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14008
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]124030..125364 [+]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDH8JZJ3
KEGG IDvci:O3Y_14008
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-161, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 63..139
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 302..374
Protein Sequence: 444 a.a.     [Download]
>gi|379743560|ref|YP_005334612.1| type VI secretion system protein ImpJ [Vibrio cholerae IEC224]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMP
DGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGD
TTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLM
RERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVK
ARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|379743460|ref|NC_016945.1|:124030-125364 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGC
AGAGATATACGGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGA
GTTGTCGCTCAACCCGGAATACCTCTCGTTTGGCCGTATTGCGATTGAGCGTGCGGTCGGCGTGATGCCC
GATGGCACCACCTTTCGTATTCCTCAAGAAGATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCAT
TGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAGTGAGTCGCTGATGGAGATTAACTGGCCAGA
AGAGCGTGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATGTCCATAGCGTGCAGGGTGAT
ACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGCAGTGCGTATG
CCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGCGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTAGTGGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATG
CGTGAGCGAGCGAAAAATATTGCTCAGCGCATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGG
ACTTTATGCTGCTGCAAGCTTTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTT
ACACCCAGAGCGTCTGTTTGAATGTCTCTCGTGTGTGTGTGGTGAGCTGGCTACCTTTACTGACGAAAGT
CGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGATCCGCA
GCTTGCGTCAGAGCTTGAGCGTGGTGCTAGAGCCGCGTGCCGTCTCTATCCAACTGGATAAACGTAAGTA
CGGTTTGATGGTTGCGCCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCATCGCGGTTAAA
GCTCGCATGCCGTTGGATGAGCTACGCCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAA
TTCGTGAACTCATCTCACTGCAACTGCCGGGTATTCCATTGACGCCATTACCCGTCGCACCGCGCCAATT
GCCTTACCACGCTGGCTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGACTCAT
TCCAGCGGTTTTGCGTTCCACGTTGCTGCAGCTTTTGACGATCTTGAGCTGCAATTCTGGGCTATCAGGA
GCTAA
 Primer design