SecReT6
Protein ID: 379743561
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14013
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]125367..126140 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDH8JZJ4
KEGG IDvci:O3Y_14013
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-69, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|379743561|ref|YP_005334613.1| type VI secretion system protein ImpK [Vibrio cholerae IEC224]
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTI
EEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRA
KYTLSRQMPVWSVFAGFIVLWVGLFLGYSYVLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|379743460|ref|NC_016945.1|:125367-126140 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGTCACAGAGTAAAAAAGAGACGCCATTAGCCAGTTTGTTGTTCGACGATGTGGAAAAAATTAACCACG
ACCAAGACTACTGGTTCCAATTGCGTGGGGACAATCCGAATGTGCTGATTGATGCCGCGACACCCTTGTT
TGGGCTTTCTCTGCGGGTTCGTACCCTCACCGAATGCGACAACATTGAACAGATCTACCGTCAGACGATT
GAAGAGATCAAAGCGATTGAAATTGAGTTGACGGAGCAAGGTTACGAACACGCCATTTTGATGGCCTATC
GCTACATCTTGTGCGCCTTTTTGGATGAATCCGTGATGGGAACCGAGTGGGGCGCGTCCAGTTTATGGGC
CGAGCACTCCATGCTGTCACGCTTCCATAATGAAACGTGGGGTGGCGAGAAAGTGTTTACGATTTTGAGC
CGTCTTGAGGGTGAACCACACCGTTACCAAGCGCTATTGGCCTTTATTTATCATTGCCTGATTTTGGGCT
TTGAAGGCAAATACCGTGTGATGGAAGGGGGACAAGCTGAGCGCGAAAAAGTGATCAGCCGCCTGCATCA
ACTGCTGAGCAGCTTGGAAGAGAGCGAGCCACAAGACTTAACCCGTCCGACCGATCATGTGGTGCGTGCG
AAATATACCCTAAGCAGACAGATGCCTGTTTGGTCTGTGTTTGCTGGCTTTATCGTGCTTTGGGTAGGTC
TATTTCTCGGCTACAGCTATGTACTGCATAGCAAATCCAGCGATGTGCTCAATCAACTCAATCAAATACT
TTAA
 Primer design