SecReT6
Protein ID: 379743562
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14018
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]126166..128775 [+]
Producttype VI secretion system protein VasG
NoteTssH
UniProt IDH8JZJ5
KEGG IDvci:O3Y_14018
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-38, Aligned region: 221..241
AAA_2 [PF07724], Evalue: 2.40E-38, Aligned region: 607..768
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 221..352
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 613..730
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 777..821
ClpB_D2-small [PF10431], Evalue: 5.20E-14, Aligned region: 774..848
AAA_5 [PF07728], Evalue: 4.80E-13, Aligned region: 221..244
AAA_5 [PF07728], Evalue: 4.80E-13, Aligned region: 612..731
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 78..114
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 200..236
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 258..299
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 583..653
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 220..313
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 516..547
AAA_22 [PF13401], Evalue: 2.20E-09, Aligned region: 609..636
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 221..262
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 607..645
AAA_14 [PF13173], Evalue: 6.30E-06, Aligned region: 221..322
AAA_14 [PF13173], Evalue: 6.30E-06, Aligned region: 490..535
AAA_14 [PF13173], Evalue: 6.30E-06, Aligned region: 611..694
Arch_ATPase [PF01637], Evalue: 6.80E-06, Aligned region: 129..163
Arch_ATPase [PF01637], Evalue: 6.80E-06, Aligned region: 201..241
Arch_ATPase [PF01637], Evalue: 6.80E-06, Aligned region: 612..652
Clp_N [PF02861], Evalue: 5.90E-05, Aligned region: 24..72
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 221..250
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 370..447
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 613..641
DUF258 [PF03193], Evalue: 9.60E-05, Aligned region: 193..238
DUF258 [PF03193], Evalue: 9.60E-05, Aligned region: 612..653
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 608..623
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 218..242
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 609..634
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 215..342
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 611..630
AAA_17 [PF13207], Evalue: 0.00058, Aligned region: 221..260
AAA_17 [PF13207], Evalue: 0.00058, Aligned region: 613..647
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 221..288
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 312..383
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 467..510
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 613..657
Sigma54_activat [PF00158], Evalue: 0.00096, Aligned region: 219..237
Sigma54_activat [PF00158], Evalue: 0.00096, Aligned region: 610..710
DUF815 [PF05673], Evalue: 0.0014, Aligned region: 217..296
DUF815 [PF05673], Evalue: 0.0014, Aligned region: 564..646
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 222..242
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 613..635
MobB [PF03205], Evalue: 0.0051, Aligned region: 221..242
MobB [PF03205], Evalue: 0.0051, Aligned region: 612..634
SRP54 [PF00448], Evalue: 0.0071, Aligned region: 221..265
SRP54 [PF00448], Evalue: 0.0071, Aligned region: 612..633
Protein Sequence: 869 a.a.     [Download]
>gi|379743562|ref|YP_005334614.1| type VI secretion system protein VasG [Vibrio cholerae IEC224]
MIRIELPTLIAKLNAQSKLALEQAASLCIERQHPEVTLEYYLDVLLDNPLSDVRLVLKQAGLEVDQVKQA
IASTYSREQVLDTYPAFSPLLVELLQEAWLLSSTELEQAELRSGAIFLAALTRADRYLSFKLISLFEGIN
RENLKKHFAMILSDSAETAVAKTDKNAANPLQAAAETPLGRFCTNVTEQARNGELDPVLSRENELNLMVD
ILCRRRKNNPIVVGEAGVGKSAMIEGLALRVVAGKVPTQLQNVELYSLDLGRLQAGASVKGEFEKRLKGV
IDAIKQSPKPIILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTVAATTWKEYKKYFEKDPALTRR
FQLVKLDEPTIDQAVDILRGLNSVYEKAHNVLITDDALKAAAELSARYISGRQLPDKAIDVLDTACARIA
INMTTPPKRLALLETLCHQRQLEIDMLERAQFLGQEVDSERLDVLRNQELADEAEKAALTQSWQQQKSLV
ESIIALRAELMELSQAQEQDPDHLLVVRTALQEQYQALDAIDHAERLMHPQVDADQIAEVIADWTGVPVD
QMNTDELHKITHLTSILGQAIKGQETAIERIHRHLLTARADLRRPGRPKGAFLLVGPSGVGKTETVVQLA
EQLYGGKQFLTTINMSEYQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRKMPYSVVLLDEVEKAHPEVLNI
FYQGFDKGEIADGEGRVIDCQNIVFFLTSNLGYQTIVDYADEPAKLDEALYPELAAFFKPALLARMEVIP
YLPLGKEVLAQIVRGKLARLEKLFKTRYNAEVVIEESLIDEILSRATRSENGARMLEAIIEGQLLPPVSL
ALLNKLAERAPVERIRLAAEAGEFIGEVA
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|379743460|ref|NC_016945.1|:126166-128775 Vibrio cholerae IEC224 chromosome II, complete sequence
GTGATCCGTATTGAATTACCCACTCTTATTGCAAAACTGAATGCACAAAGCAAATTGGCTCTGGAGCAAG
CTGCCTCTCTCTGTATTGAGCGCCAACACCCTGAAGTCACTCTAGAATATTATCTGGATGTGTTACTGGA
TAATCCCCTCTCTGATGTGCGTCTCGTACTCAAGCAAGCGGGGCTGGAAGTCGATCAGGTGAAACAGGCC
ATCGCATCAACCTATAGCCGTGAACAGGTCTTGGATACCTATCCAGCGTTTTCGCCACTGCTGGTCGAGT
TACTGCAAGAAGCTTGGCTGCTTTCCAGTACCGAGTTAGAGCAGGCTGAGCTGCGTTCAGGGGCGATTTT
CTTAGCCGCGCTGACCCGTGCGGACCGTTATCTGTCATTCAAATTGATCAGTTTGTTTGAAGGCATCAAC
CGCGAAAACCTCAAAAAACACTTTGCGATGATCTTAAGTGATTCTGCAGAAACCGCAGTGGCTAAAACAG
ACAAAAATGCGGCCAATCCACTGCAAGCCGCCGCAGAAACACCACTCGGACGCTTTTGCACGAATGTGAC
TGAGCAAGCCCGTAACGGTGAGCTTGATCCTGTCCTGAGCCGTGAAAATGAACTCAACTTGATGGTGGAT
ATTCTGTGCCGTCGCCGCAAAAACAACCCGATTGTGGTGGGTGAAGCAGGTGTTGGTAAAAGTGCCATGA
TTGAAGGTTTGGCGCTGCGTGTGGTGGCTGGCAAAGTGCCCACCCAACTGCAAAATGTAGAACTCTATTC
GTTGGATCTTGGTCGCTTGCAAGCGGGTGCATCGGTGAAAGGCGAGTTCGAAAAGCGCCTAAAAGGGGTG
ATTGATGCGATTAAGCAATCGCCTAAACCGATCATTTTATTCATCGATGAAGCGCACACCTTAATTGGTT
CTGGTAACCAAGAAGGGGGCAGTGATGCGGCAAACTTGCTCAAGCCTGCGCTGGCGCGTGGTGAGTTAAG
CACAGTGGCGGCGACGACGTGGAAAGAGTACAAAAAGTATTTTGAAAAAGATCCCGCGCTGACGCGCCGT
TTCCAACTGGTCAAACTCGATGAACCAACGATCGATCAAGCCGTCGATATTCTGCGCGGTCTTAACAGTG
TCTATGAAAAGGCACACAACGTACTGATCACTGATGATGCACTAAAAGCTGCCGCTGAACTGTCAGCGCG
TTACATCTCAGGTCGTCAACTGCCCGATAAAGCGATTGATGTGCTGGATACCGCTTGTGCGCGGATTGCG
ATCAATATGACCACGCCACCTAAGCGTTTAGCGCTACTTGAAACCTTGTGCCATCAGCGTCAACTCGAAA
TTGACATGCTAGAGCGGGCGCAATTCCTTGGCCAAGAGGTCGATAGCGAGCGCCTCGATGTTTTGCGTAA
TCAAGAGTTGGCCGATGAAGCGGAAAAAGCCGCGTTGACACAGAGTTGGCAGCAGCAAAAAAGCTTGGTG
GAGTCGATCATCGCACTGCGTGCTGAGCTGATGGAGTTAAGCCAAGCGCAAGAGCAAGATCCCGACCATT
TATTGGTGGTGCGTACGGCGCTGCAAGAGCAGTATCAAGCACTCGATGCGATTGATCATGCTGAGCGCTT
GATGCACCCGCAAGTCGATGCGGATCAGATTGCTGAAGTGATCGCCGATTGGACGGGCGTGCCTGTTGAT
CAGATGAACACCGATGAGCTGCATAAAATCACCCATTTGACCTCGATTTTAGGCCAAGCGATCAAAGGCC
AAGAAACGGCCATCGAACGTATCCATCGTCACTTACTGACAGCGCGTGCCGATCTGCGTCGTCCGGGACG
TCCGAAAGGGGCATTCCTGCTGGTGGGGCCAAGCGGTGTAGGTAAAACCGAAACGGTAGTGCAACTGGCA
GAGCAGCTTTACGGTGGTAAACAGTTCCTCACCACCATCAACATGTCGGAATACCAAGAGAAACACACCG
TTTCCCGCCTGATTGGTTCACCTCCGGGTTATGTTGGCTACGGTGAAGGCGGTGTGCTGACGGAGGCTAT
CCGTAAGATGCCTTATTCGGTGGTTCTGCTTGATGAAGTCGAAAAAGCCCATCCAGAAGTTTTAAATATC
TTCTACCAAGGCTTTGATAAAGGCGAAATCGCCGATGGTGAAGGTCGTGTCATCGACTGCCAAAACATCG
TGTTCTTCCTGACATCGAACTTAGGCTACCAAACCATAGTCGATTATGCCGATGAGCCCGCCAAGCTTGA
TGAAGCGCTTTATCCTGAATTGGCCGCTTTCTTTAAACCTGCTCTGCTGGCGCGTATGGAAGTGATCCCT
TACCTACCACTGGGTAAAGAAGTGTTGGCACAGATTGTTCGCGGCAAGCTGGCTCGTCTCGAGAAACTGT
TCAAGACACGTTACAACGCAGAAGTGGTGATTGAAGAGAGCTTAATTGACGAAATCTTAAGCCGTGCGAC
ACGCAGCGAAAACGGTGCGCGTATGCTGGAGGCGATCATTGAAGGGCAATTGCTGCCGCCCGTTTCATTG
GCGCTGCTGAATAAACTCGCCGAGAGAGCGCCCGTTGAGCGCATTCGTTTAGCGGCAGAAGCGGGTGAAT
TTATCGGAGAGGTAGCGTAA
 Primer design