SecReT6
Protein ID: 379743564
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14028
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]130367..131023 [+]
Producttype VI secretion system protein VasI
NoteVCA0118
UniProt IDH8JZJ7
KEGG IDvci:O3Y_14028
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 4.60E-59, Aligned region: 32..212
Protein Sequence: 218 a.a.     [Download]
>gi|379743564|ref|YP_005334616.1| type VI secretion system protein VasI [Vibrio cholerae IEC224]
MRITVLVVSLILDCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQVAIAPSNPYP
AEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEV
ADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFDTRGVNEALD
ALRERCGW
 
Nucleotide Sequence: 657 bp     [Download]
>gi|379743460|ref|NC_016945.1|:130367-131023 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGATTGCGCGGGCTCTGCGCATGTTTTAGCAGCAT
CGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCGCGAAATTCCTGCGCGTTTAGAGCGTTT
GGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTGGCTATCGCACCGTCCAATCCTTATCCC
GCAGAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGTCCGAAGCGGGTTGGGTATTAGGTACGC
AAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGCGCAAAATCGCAGCTCAGGGGAAACATC
TCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGCATTGAGCTGGCTTTACCGAAAGAAGTG
GCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGTTCTGGCGCAGTGACGATCACGGCGTAC
TGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAAATTGGCCGCCAGTGAGTCTCGCCTGTT
GCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGATACTCGAGGTGTCAATGAAGCCCTTGAT
GCTTTGCGCGAACGCTGTGGTTGGTAA
 Primer design