SecReT6
Protein ID: 379743565
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14033
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]131033..132442 [+]
Producttype VI secretion system protein VasJ
NoteTssA
UniProt IDH8JZJ8
KEGG IDvci:O3Y_14033
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 49..109
PPDK_N [PF01326], Evalue: 0.0077, Aligned region: 81..199
Protein Sequence: 469 a.a.     [Download]
>gi|379743565|ref|YP_005334617.1| type VI secretion system protein VasJ [Vibrio cholerae IEC224]
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKLLGEQSKDIKL
LVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKFFSQMAQRFTTVIEKFDFHHL
DEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEIKRAEQRQQVTAQSSAERETPSAATPSPAAS
MVVDHSSDKAAKQTLLKVADFLAEQEFGIALSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQ
DQLRHPDLALWRKVEQSLTMAPYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGE
PFVSDSVKEWLASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|379743460|ref|NC_016945.1|:131033-132442 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGGAAATGACTGAATACCGTCAGTGTGTGGCCAAACCGATCAGCAGTAGCAATCCTGTCGGAGAGCGGC
TAGTCGATCACCCACTGTTTGATTTTATTGAGGATCAGATGATGAAAGTGGGCTCTCTCTCTCACGCTTC
AGTGCAGTGGGATGAAGTGGAGCACAGCACTCTCAAACTGCTTGGTGAACAGAGTAAAGACATCAAGCTT
TTGGTTTACCTGCTGCAGTGTCTGCATAACCAAGTTACCCCGACGCGCCTTATTACCTCGTTTGCGGTGA
TGAGTGAGTTCCTCAATCAATATTGGAACGACAGTTATCCAGCGCCGGGCCCACGTGGCAATCTGCCGCG
ACGTAAATTTTTCAGCCAGATGGCGCAACGTTTTACCACGGTGATCGAAAAGTTCGATTTTCATCATCTG
GATGAAGCGGATCGCCAAGCGCTACAAGCGGCGGTTGAAGAGTGGCAACAAGCCGTTGAGAAACAAGGGC
TCTCTTCTGAGTTGGTGGAGTCTGTGGTGGTGCGAATTACCGCGGAGATCAAACGCGCAGAGCAGCGCCA
GCAAGTGACGGCGCAAAGCAGCGCGGAGCGTGAAACACCAAGTGCTGCAACGCCTTCTCCTGCGGCGAGT
ATGGTGGTGGATCATTCGAGTGACAAAGCAGCGAAACAAACCCTACTCAAAGTGGCAGATTTTCTTGCCG
AACAAGAGTTTGGTATCGCTCTTTCGATTCGTCTGCGCCGCTTTGCGGTGTGGGGCAGCATTACCTCATT
GCCCGATCATAAACCCGATGGTGAAACACTGCTGCGTGGAATGCAGGCGGATCGCGTCAAGGATTACCAA
GATCAACTTCGTCACCCCGATTTAGCCTTGTGGCGCAAAGTCGAACAGAGCTTAACCATGGCTCCTTATT
GGTTTGAAGGACAGTGGATGAGTTACACCATTGCCCAGCAACTCGGCAAAAGTGATTGGTGTCAGGCGAT
TGCCGAAGAAACACAACAGTTTTTACGTCGTTTGCCTTCGCTGCTTGAGCTCAAATTCAAAGGCGGAGAG
CCGTTTGTCAGCGATTCGGTCAAAGAGTGGCTGGCGAGCGTAGGTCAGAGCCAAGGTGCTGCGGGGCAAT
CGGTCGGCGGAGATTGGCAAGAGAAGCGTAAAGAGGCGTTTCAACTGGCTAAAGAAGGTGGAATCGCGGT
GGCACTTTCCATGCTCAATGATGGCTTGGTCAGTGCGGTGGAGCCGCGAGACAAATTTTACTGGCGATTG
CTATCGGCAGATCTGCTGCGGGCAAATCATCTCGATGCGATGGCTGGTGAACAGTATCAAACTCTGCTCA
ATCAGGTAACGACGCTGTCTGTTCCTGAGTGGGAACCGAGTTTAGTGGAACAAATTCAAAGATATACAAC
GTCAGAGTAA
 Primer design

Protein ID: 379743567
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14043
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]136054..137316 [+]
Producthypothetical protein
NoteTssA
UniProt IDH8JZK0
KEGG IDvci:O3Y_14043
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.10E-11, Aligned region: 46..100
Cytochrom_B562 [PF07361], Evalue: 0.0062, Aligned region: 119..135
Cytochrom_B562 [PF07361], Evalue: 0.0062, Aligned region: 171..184
Cytochrom_B562 [PF07361], Evalue: 0.0062, Aligned region: 324..396
Uds1 [PF15456], Evalue: 0.0073, Aligned region: 122..159
Uds1 [PF15456], Evalue: 0.0073, Aligned region: 295..339
Uds1 [PF15456], Evalue: 0.0073, Aligned region: 379..417
Protein Sequence: 420 a.a.     [Download]
>gi|379743567|ref|YP_005334619.1| hypothetical protein O3Y_14043 [Vibrio cholerae IEC224]
MSNVIFIGNLCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICGY
YAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYRA
ERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGVL
GVALGMVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTIS
FSEPKRHAITQLNLLRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKWA
ELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALLQ
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|379743460|ref|NC_016945.1|:136054-137316 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGTCCAATGTGATTTTTATTGGTAACCTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCGGAT
TAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTCAATCCGATTGCTGGGGGCACGGATTG
GGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGTTAC
TATGCGGTAGCCTGCCTGAAAACTCAGGGGTTAGCGGGGTATGCCACCGGTATGGAGCTGATGAGTGCAA
GCCTTGCCAACCAAGGTGAGTGTGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTTGATTGGGTCAA
TGCACGTGTGGTGCAGGAACTGAAAGCACTTAAGCCAACTTATGAGTCGCTGCGAGATCTGTATCGGGCT
GAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAGCAACAAACCGAATACAAAGTAGACTTTGAAG
GGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAAGCA
GGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTACTC
GGGGTTGCACTGGGAATGGTGGGGGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCGCGC
CACAGCGCATCACTACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCCACAAGTGA
GCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATCTCG
TTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACGAGC
AAGTGAATGCACTGAGTCAAGAGTTTGCCCTTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTTCGT
GGCTAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCTCGTTATTGGCTAAGCGAGGGAAATGGGCT
GAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAGTTG
ACTATGTGCAAGGCCTCCTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAAACA
AAGGCTAGATAGCCTAAGTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTGCAG
TGA
 Primer design