SecReT6
Protein ID: 379743566
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14038
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]132503..136003 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDH8JZJ9
KEGG IDvci:O3Y_14038
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.70E-93, Aligned region: 494..810
ImcF-related_N [PF14331], Evalue: 4.70E-81, Aligned region: 186..443
DUF1215 [PF06744], Evalue: 2.70E-38, Aligned region: 904..1024
Protein Sequence: 1166 a.a.     [Download]
>gi|379743566|ref|YP_005334618.1| type VI secretion system protein ImpL [Vibrio cholerae IEC224]
MVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAVWGIWQWRKLQAFKSE
QKREEQLRQDPIKVYEQRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLGLENAGKTSLINRSGQNFVFS
SVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRSEENDGALERRLWLHFVDWLDRTRSRRPLNG
IVLALDVAHLATATASERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGFEPFFKHYTKSQREEV
LGFTFSMDSVDNLDSWLEEFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFTRQISGLKEILQQFFQ
EALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNSTVYFTQKLFTHIIYP
EAGLASDNFRVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKVNQYKEQFPTSRSLAS
QREVLDPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKVEETYLNLLETRFLPLLMADTIVALNQA
ETDEEKLAVLRVYRMLVDKSGRYQDYVMDYFAKYWQKSFSGQRQIQEELLGHLDYAMRHTDLTAERLNGD
KGAEQVMRPYDKVIARAQVELGSMPNDQRVYRNLKLSAQTVLGPSVNLRSLIGPVFDVVFEERVLNSSSL
FIPQMLTKRGFDDYFMPQSESVSELALIDSWVLGQSKTAQFSEADKQALREKIRDLYVADYTNTWRAALN
EIDVKYFNDINDAVMVLENITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELLKSPKYKVASMIETPF
ADLNGMLKPVGSKPAYMTEVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLVNADPIYTLKRISSGL
PKPLDSMMAKLADESWYVVKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFNPASNKDVALADFEAFFAPNG
TLDNFYNQQLKMFIDENISVASDDSAQSIIRKEVLDQIKQAQKIREAFFNRKGILDVSFSVEPLSLSNNK
RRSVLNVDGQFLAYSHGPRENVELIWPNTLRDSAVSKVTLIPTQTNMSPRSLQIQGPWAFFRLLDQGDVV
SASQTSVDFKFIVDGGEMIYRINAEADANPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|379743460|ref|NC_016945.1|:132503-136003 Vibrio cholerae IEC224 chromosome II, complete sequence
GTGGTGGCAGCACTTCCCATTTTGCTATTCACTACGTTCATTTTGCTGAACGTTGCCATTTGGTGGGCAG
GCCCTTGGTTAGAAGTGGCTGGCTATAAACCGCTGGAGTCGATCATGGCTCGAGTTGTGGCAAGCAGTCT
GTTTACTCTCGGCTGTTTAGCCGTGTGGGGCATTTGGCAGTGGCGTAAGTTGCAAGCCTTCAAATCGGAG
CAAAAGCGCGAAGAGCAACTGCGCCAAGATCCGATCAAGGTGTATGAGCAGCGCCAAGAGGTTGAACTGA
ATCAGGTGATGCTCAATATGAAGCAGAGCCTAAATAAACACAACTACTTGTATGCACTACCTTGGTATTT
GGTTCTAGGTTTAGAAAATGCGGGTAAAACCAGCCTGATCAACCGTTCTGGTCAGAACTTTGTCTTCTCT
TCGGTCATGCGAGCTTCGGGACAAAAAAGCGAAAACCCATACTCGTTTGATTGGTGGATTGGTGATGAAT
CTGTCCTGATTGATCCTGATGGTGAGCTGTTAACGCAAGGCAATCGTAGTGAAGAAAATGATGGTGCGTT
AGAGCGCCGCTTATGGTTGCATTTTGTCGATTGGCTAGACCGCACTCGTAGCCGCCGCCCGTTAAACGGC
ATCGTGTTGGCGTTGGATGTGGCGCATCTTGCTACCGCCACCGCCTCAGAGCGTAAAGCTTATGCCAATT
TGCTGCGTGCTCGTCTGCGTGAGTTGATGGAAACCTTATCGACTCGTCTGCCGGTGTACATTGCACTGAC
TAAGCTCGACTTACTGCACGGTTTTGAGCCTTTCTTTAAGCACTACACCAAAAGTCAGCGCGAAGAGGTG
TTGGGTTTTACCTTCTCAATGGATTCGGTAGATAACCTAGATTCATGGTTGGAAGAGTTTGCCAGTGAGT
ACACTCAATTTGTGTCACGAGTTAATGGCATGCTGCCGCATGCGGTCGCAGCGCCAATGACGCTTGAAGA
ACGTAACGCGATTTACAGCTTCACGCGTCAAATCTCAGGTTTGAAAGAGATTTTGCAACAGTTTTTCCAA
GAGGCTTTGGCGAGCGATCAATTCTCAACGTCAGCGCTGGTGCGTGGTGCCTATTTCACGTCGGTTTACC
AACAAGGTGTACCTACCAACGCTTTTGATGATGCGGCTTCCCGTCGTTATGGTCTGTCTCATGCGATTAA
TACGGCGCAGCGCGCGAAAAACTCCACGGTCTATTTCACGCAAAAACTGTTTACCCACATCATTTATCCT
GAAGCGGGTTTAGCGTCGGATAATTTCCGGGTTGCAAAAAACAAACGCCGTTTGATGGGGCTCTCTTTTG
TCGCATGCTCAGTGGCGACTTTGCTGTTGGCGGGAACTTGGCATCGTAACTACCTCAATAACGTGCAACA
CGCCGATACTGTATTAACCAAAGTGAATCAGTATAAAGAGCAGTTCCCGACCAGCCGTTCATTGGCCTCA
CAAAGAGAGGTATTGGATCCGTTGAACAAGATCCGTGAGGCGACACTGGAGTTTGGTTTCTTCCGTGATA
AACCTCAGTACATCTCCGATTTTGGTCTCTACCAAGGGCACACCATTGGCCCGAAAGTAGAAGAGACCTA
CTTAAACTTACTCGAAACTCGCTTCTTGCCTCTGTTGATGGCGGACACCATTGTTGCGCTCAATCAAGCT
GAGACAGATGAAGAAAAATTAGCGGTGCTGCGTGTGTATCGCATGCTGGTCGATAAAAGTGGTCGTTACC
AAGACTATGTGATGGATTATTTTGCGAAGTATTGGCAAAAATCCTTCTCAGGTCAGCGTCAAATTCAGGA
AGAGCTGCTCGGCCACTTAGATTACGCGATGCGTCATACGGACCTCACTGCAGAGAGGCTCAATGGTGAT
AAAGGGGCGGAGCAGGTGATGCGCCCTTACGATAAAGTGATTGCTCGTGCTCAGGTTGAACTGGGTTCAA
TGCCAAACGACCAGCGCGTCTATCGTAACTTGAAATTGAGCGCACAAACGGTGCTTGGTCCTTCGGTTAA
CTTGCGTAGCTTGATTGGGCCGGTGTTCGATGTGGTGTTTGAAGAGCGCGTTCTTAACAGTAGCAGCCTG
TTTATTCCTCAAATGCTCACCAAGCGTGGTTTTGATGACTACTTTATGCCGCAATCTGAATCGGTCTCTG
AGCTGGCACTGATTGACAGTTGGGTTCTGGGACAGAGCAAAACGGCACAGTTTAGTGAAGCAGACAAGCA
GGCACTGCGCGAAAAAATCCGCGATCTTTATGTGGCGGATTACACCAACACATGGCGCGCGGCACTCAAT
GAAATTGATGTGAAGTATTTCAATGACATCAATGATGCGGTCATGGTTTTGGAAAATATCACCAGTAACC
TTGAGCCGATGCAGCGTCTACTGCGCACATTAGATGACAACACCCAACTGTACAGTGCGTTACCTAAAGA
TGAATCGGCGTTAAAAGAGCTGCTGAAAAGTCCGAAATACAAAGTGGCTTCGATGATTGAAACTCCGTTT
GCTGATCTGAACGGTATGCTCAAACCGGTGGGCAGCAAACCAGCGTACATGACGGAAGTCTTGGCTTCGG
TGGATGAGCTGAAAAGCTACTTGAAATCGATTCAAGATGCTCCCGATGTCGGTATGGCGGCGCTCGATGC
GACCAAAGCGCGGGTCAAACTGGTTAATGCTGACCCTATCTATACCTTAAAACGTATCTCGTCAGGACTG
CCGAAGCCGCTGGATAGCATGATGGCAAAGCTTGCAGATGAGAGCTGGTATGTGGTCAAGCAAGAAGCGA
TCAAGCATCTGGAAGTTCGCTGGACGGAGGATGTGTATAAAACCTTCCAAAGCAAGCTGGCTGGGCGTTA
TCCATTCAACCCCGCATCAAATAAAGATGTTGCCTTGGCCGATTTTGAAGCCTTCTTTGCGCCGAATGGC
ACGTTAGACAACTTCTACAATCAGCAACTGAAGATGTTTATTGATGAGAACATCAGCGTCGCGTCGGATG
ACTCAGCGCAGTCGATCATTCGTAAAGAAGTGCTGGATCAGATCAAGCAAGCGCAGAAAATTCGTGAGGC
TTTCTTCAACCGTAAAGGGATTTTGGATGTCAGCTTCTCGGTTGAGCCGCTCAGTTTGAGTAACAACAAG
CGTCGTAGTGTGCTGAATGTGGATGGTCAGTTCTTAGCTTACAGCCATGGTCCGCGTGAAAATGTGGAGC
TGATTTGGCCTAACACGCTGCGTGATTCTGCGGTGTCTAAGGTGACCTTGATTCCAACCCAAACCAATAT
GTCACCGCGCAGTTTGCAAATCCAAGGACCGTGGGCATTCTTCCGCTTATTGGATCAAGGTGATGTGGTT
TCGGCGAGTCAAACGTCGGTTGATTTCAAATTTATCGTCGATGGCGGTGAGATGATCTACCGTATTAACG
CAGAGGCCGATGCCAACCCATTTACCGAACGCCTGTTCAAGTCGTTCAAACTGTCTAAAACACTCTATTA
A
 Primer design