SecReT6
Protein ID: 379743570
SecReT6 ID557
T6SS typei1
Gene symbol-
Locus tagO3Y_14058
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]140619..140987 [+]
Producthypothetical protein
NoteTsiV3 (i)
UniProt IDH8JZK3
KEGG IDvci:O3Y_14058
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 122 a.a.     [Download]
>gi|379743570|ref|YP_005334622.1| hypothetical protein O3Y_14058 [Vibrio cholerae IEC224]
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNERAESETQIRNNISSKSIDYGFPDDF
YSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
 
Nucleotide Sequence: 369 bp     [Download]
>gi|379743460|ref|NC_016945.1|:140619-140987 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGAATAACTTGCTTTCTGCGTATGTAACTATGCTGTTGATATTATTAAGTATTAGTGGTGGCGCTATTG
CTAGTGAAAACTGCAATGATACATCTGGAGTGCATCAAAAAATTCTAGTGTGTATCCAAAATGAGAGAGC
TGAGTCAGAGACTCAGATTAGAAATAATATTTCTTCTAAGTCTATAGATTATGGCTTTCCTGATGATTTC
TACAGCAAGCAAAGATTAGCTATTCATGAAAAGTGTATGCTTTATATAAATGTCGGTGGCCAACGTGGTG
AATTGCTAATGAACCAATGTGAACTTTCGATGCTACAAGGCCTTGATATTTACATTCAACAGTATATAGA
GGATGTTGATAATAGTTAG
 Primer design