SecReT6
Protein ID: 383188511
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0572
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]590594..593929 [-]
Producthypothetical protein
NoteTssM
UniProt IDH2ITP7
KEGG IDraq:Rahaq2_0572
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-74, Aligned region: 392..710
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 236..262
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 830..950
Protein Sequence: 1111 a.a.     [Download]
>gi|383188511|ref|YP_005198639.1| hypothetical protein Rahaq2_0572 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MINPFASRPSGASLLAMVFGAILAAVLYFFSERWGLSPLLRSLIWALGMALLFAVMAIYRNSRRPPPARS
PVSKKETHSAADGETQSPYTEELCDYLRHRYGRFWRSKVRLVVLVGQSRLVGMIAPELISQQWIEADGTV
LLWGGNITSASDSNRIAALRKLRRRPPQAIVWVCDARHQQVSLADTAARQLRDRAKLLGWQVPLYVWQIE
NSESPPASRETQPIGCLLPANSTPQMLEEALRELTSQLTVQGTQQVLQKPADDFMLRLSHQLLNGEIARL
RATLAPLLSGPYAAPLRGIMFSQPLRFVEGVDKFRWLPDASWKGILNDLSSVRAKRIGIPWAKGLRYSLA
GLLIFWCFAAVLSFTANRAVLRESVDLTVRISDPAIPLEKRLMNLQELQRKIGQLQYRAVHGAPWYLRFG
MNQNEALLAALWPHYLKINNTFIRDAAASKLTQQMNALLSLPPDSPQRGLMARQAYDQLKAYLMMARPEK
MDAQYFTTTMMKQWPQRNGVSDAVWRNYGPSLLSFYAQNLSAHPQWKITQDEAMVGQVRTLLLRQIGMRN
AEASLYQKMLLQVARHYADMHLEDMVGDTSARPLFSTDSVVPGMFTRKAWEEAVQPAIDDVVNTRRDEID
WVLNDNKHPVKEDISPQALKARLTERYFADFSGAWLGFLNSIHWRRADTLSDAIDQLTLLADIRQSPLVA
LLNTLDYQGKTGRQNEALTESLVKSAQNLIHADQKPAIDQRDKNTKGPLDDTFTPLLTLMNSNAGGDGYN
SLSLQSFLTRITRVRLRLQQVTNTADPQAMTQALAQTVFQGKSVDVTDTRDYGSLVAASLGQEWSGFGQA
MFVQPMEQAWQQVLTPTAESINAQWRNAIVQDWSADFNGRYPFAPVQSEVSLALMSQYLRNDTGRIARFI
TTNLNGVIKRQGRHWEPDVISAQGLHFDPEFLQALNQLSELADVVFTHGDASLHFELMAKPAKDVMQTEL
TLDQQNLKYFNQMESWQPFNWPDSQWKPRVTLSWVSVRAGTRLYADYPGIWGFIRLLEKAKVTQIDSSTF
RLVWKAPDGLPLNYLMRTEAGEGPLALLALKGFKMPQSIFLPPPATANDAGDNQSGSDTPD
 
Nucleotide Sequence: 3336 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c593929-590594 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGATTAATCCCTTTGCATCCCGCCCTTCCGGAGCCAGTTTGCTGGCGATGGTATTTGGTGCGATTCTCG
CCGCGGTTTTGTATTTCTTTAGCGAACGCTGGGGGCTCAGCCCGTTGCTGCGCAGTCTGATCTGGGCGCT
GGGCATGGCACTGTTATTCGCAGTGATGGCTATTTATCGCAACTCACGTCGGCCCCCGCCCGCCCGGAGC
CCCGTATCGAAAAAAGAAACGCATTCTGCTGCTGACGGCGAAACACAATCCCCTTATACAGAAGAGCTTT
GTGATTATCTGCGCCATCGTTATGGACGCTTCTGGCGGTCGAAAGTCCGGTTAGTTGTTCTGGTCGGTCA
ATCCAGGCTTGTGGGGATGATTGCCCCCGAACTGATTTCACAACAGTGGATTGAAGCCGATGGCACCGTA
CTGTTATGGGGCGGTAACATCACCTCAGCATCAGACAGCAACCGTATTGCGGCGCTGCGCAAATTACGCC
GCCGCCCGCCTCAGGCCATCGTCTGGGTATGTGATGCCCGTCATCAGCAGGTTTCGCTGGCCGACACCGC
CGCACGTCAGTTACGTGATCGCGCGAAATTACTCGGCTGGCAGGTTCCCCTCTATGTCTGGCAGATTGAA
AATAGCGAATCGCCCCCGGCGTCCCGTGAAACCCAACCCATCGGATGCTTGTTACCCGCAAACAGTACGC
CGCAAATGCTGGAAGAAGCGCTGCGGGAACTGACATCACAACTGACGGTACAGGGGACTCAGCAGGTGCT
TCAAAAGCCCGCCGACGATTTCATGTTACGCCTCTCACATCAGTTACTGAACGGGGAAATTGCACGCCTG
CGCGCAACCCTTGCGCCGTTATTATCGGGCCCGTATGCCGCCCCTTTACGCGGCATCATGTTTAGTCAGC
CATTACGCTTCGTCGAAGGCGTCGATAAATTTCGCTGGCTGCCTGATGCCAGCTGGAAGGGGATCCTCAA
TGACTTGTCCTCTGTGCGGGCAAAACGTATAGGCATCCCCTGGGCAAAAGGTCTGCGTTATTCCCTTGCC
GGATTATTAATTTTCTGGTGTTTCGCTGCCGTGCTGTCGTTTACGGCTAACCGTGCCGTACTCAGGGAAA
GCGTCGACCTCACCGTCAGGATATCTGATCCCGCTATCCCGCTGGAAAAACGCCTGATGAACCTGCAAGA
GCTGCAACGGAAAATAGGCCAGTTGCAGTACCGGGCAGTCCACGGCGCGCCCTGGTATTTACGTTTTGGC
ATGAATCAAAACGAGGCACTTCTTGCCGCGCTGTGGCCGCATTATCTGAAGATTAACAACACATTTATTC
GTGACGCCGCCGCAAGCAAACTGACACAACAGATGAACGCATTGCTGAGTCTGCCCCCCGATAGTCCGCA
GCGCGGCCTGATGGCCCGACAAGCCTATGATCAGCTCAAAGCCTATCTGATGATGGCCCGCCCTGAGAAG
ATGGACGCGCAATACTTCACCACGACAATGATGAAACAGTGGCCTCAACGCAACGGCGTGAGTGACGCGG
TATGGCGTAATTACGGCCCTTCACTGCTGAGCTTTTATGCCCAGAACTTGTCTGCGCATCCGCAGTGGAA
AATCACGCAAGATGAAGCGATGGTGGGTCAGGTGCGCACCTTGCTGTTACGCCAGATTGGCATGCGAAAC
GCGGAAGCTTCGCTATATCAGAAGATGCTGCTACAGGTTGCCCGTCACTATGCCGACATGCACCTTGAAG
ATATGGTGGGTGATACTTCTGCCCGCCCGTTGTTCAGCACCGACAGTGTGGTTCCGGGTATGTTCACCCG
CAAGGCCTGGGAAGAGGCGGTACAGCCCGCTATTGATGACGTGGTCAATACCCGCAGGGATGAAATTGAC
TGGGTGTTAAATGATAACAAGCACCCTGTCAAAGAAGATATCTCACCGCAGGCGCTGAAAGCACGGCTGA
CTGAGCGCTACTTTGCAGATTTCTCCGGTGCATGGCTCGGTTTTCTGAACAGCATTCACTGGCGTCGTGC
TGACACATTATCTGATGCCATCGATCAACTGACGCTGTTGGCTGACATCAGGCAATCGCCGCTGGTCGCC
CTGTTAAATACGCTGGATTATCAGGGAAAAACGGGGCGGCAGAACGAAGCATTGACCGAATCACTGGTCA
AATCCGCGCAGAATCTGATTCATGCAGATCAAAAACCCGCCATTGATCAGCGGGATAAAAACACGAAGGG
ACCTCTTGATGATACTTTCACGCCCTTACTGACATTAATGAACAGCAATGCTGGCGGCGATGGCTATAAC
TCACTGAGTCTGCAAAGTTTCCTGACCCGGATAACCCGCGTACGTCTCAGGTTACAACAGGTGACCAATA
CCGCTGATCCGCAGGCAATGACCCAGGCACTGGCACAAACCGTCTTTCAGGGAAAATCGGTGGATGTCAC
CGATACCCGCGATTACGGCAGTCTGGTTGCCGCCAGTCTGGGTCAGGAATGGAGCGGATTTGGCCAGGCT
ATGTTTGTTCAGCCGATGGAACAGGCCTGGCAACAAGTGCTCACCCCCACCGCAGAAAGTATTAATGCAC
AGTGGCGAAACGCCATTGTTCAGGACTGGAGCGCCGATTTTAATGGCCGTTACCCCTTTGCCCCCGTGCA
AAGTGAAGTCTCTCTGGCCTTGATGTCACAATATCTTCGCAACGACACCGGACGTATTGCGCGCTTTATC
ACCACCAATCTCAATGGCGTGATTAAACGTCAGGGACGTCACTGGGAACCGGACGTTATCAGCGCACAGG
GATTACATTTTGACCCGGAATTCCTTCAGGCGCTGAATCAGCTTTCCGAACTTGCCGATGTGGTGTTCAC
TCATGGCGACGCCAGCCTGCACTTTGAACTGATGGCCAAACCGGCCAAAGACGTGATGCAAACCGAGCTG
ACCCTCGATCAGCAAAACCTGAAATACTTTAACCAGATGGAAAGCTGGCAGCCCTTCAACTGGCCTGACA
GCCAATGGAAACCCCGCGTAACCTTAAGCTGGGTAAGCGTCCGGGCAGGCACCCGTCTGTATGCCGATTA
TCCGGGGATCTGGGGATTTATCCGCCTGCTGGAAAAAGCAAAAGTGACGCAAATCGATTCCAGCACCTTC
AGACTCGTATGGAAAGCGCCAGACGGTTTACCTCTTAACTATCTGATGCGAACCGAGGCAGGAGAAGGCC
CGCTGGCGTTACTGGCGCTGAAAGGATTCAAAATGCCGCAGTCAATTTTCCTTCCTCCGCCAGCCACTGC
AAATGATGCCGGTGATAACCAATCCGGCTCCGACACACCAGATTAA
 Primer design