SecReT6
Protein ID: 383317043
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1798
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1913771..1917358 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDH8KZG1
KEGG IDfau:Fraau_1798
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.50E-82, Aligned region: 512..823
ImcF-related_N [PF14331], Evalue: 1.50E-68, Aligned region: 210..459
DUF1215 [PF06744], Evalue: 1.10E-31, Aligned region: 934..1058
MMR_HSR1 [PF01926], Evalue: 0.00055, Aligned region: 142..238
Protein Sequence: 1195 a.a.     [Download]
>gi|383317043|ref|YP_005377885.1| type VI secretion protein IcmF [Frateuria aurantia DSM 6220]
MIISWLRSLFSFLFARELWIALAVLLLAVLIWGYGPLLALGTWHPLTAAWARVGVIGLLIMALLWRWSWR
FGGGSGRRLLEQLRRRREAVPAPPPEVQASELRQRFQQALWTLRDARADSRRWTHWLDRLSGQYVYRLPW
YLVVGDTGSGKTALLHQLRGGAPSLEFAGAAGGGAHTAQLEWHLGDSAVLVDTPGRFIEAAPAADSDRVE
FHQLLRHFRPRQPLNGVVLVIDVSQLPGMASDVRKAHGRRLRTHLLELQQGLDIRLPVYLVLTHVDRLTG
FQAYFHELGPQGREQVWGFTGNASETPARQGLETIFLREFKALVDRLGDGLIDVLASEPELGDRAEAWLF
PQEFAQLEQPLLEWLTALSRASRFEPELWLRGVYFTSNGRGGAVIEQVLAPIRQTLQLEPHAAEAVPEGR
QSYFSARLLDHLMVPEAGLAGINRRLLWRRRLLHGASLGLLATVVLVCLAVWINSYRHNRDYLAEVGRHA
AEYQARAGSHISLPAGDIEALAPLLDPLLQLPLSRQFDTTHPPFYSYRAGLYQGHKIQIATNLVYRRALE
EKLLPQAASRIQNLLASAPADDLEYTYNALKAYLMLYQSGHYQADFLSAWLLLDVEKSMPEVTTRHQREA
LENHVAELFQPHPVTSPFPFDADLVRSARERLARYSLPQRAYHQMQRRLLGSMRGDPVSVESVAGPQASM
ALVRKSGQPLSDGIAPLYTYQGYWDVFSPQVGHAALDMEKEDVWVLGSRQAPILDDLDRSRLTREIKRLY
FNDYIRVWDAYLGDLTVIETRSVNQSMQLARILSATDSPLKRFMLVAARETTLLHDRQSQPSHSLLGRAQ
ARIGEVKQSLTDIFGNQVIPANRAETEDRIESMVDNHFEPLHRMVDGSGSDGQGPSPLDTSLQVVDELYN
YLTATDAALGSGNPPPPSDVFNKLQAEAGRMPMPFRQIMGDLAVRGSAQVTGAVQHSIDEDAAASIGRLC
RQTIADRYPFVRGISRDVAIDDFSRMFAPNGLMDAFYQKNLAARVDMNTRRWTFRPSAGGVRHGNPHLLE
AFQNAETIRNVFFAAGGNRPSLKFDVMPLDLDASINQFTLDVDGQVLRYAHGPQISRTMSWPVQAGSHQV
RLELTPASASGSLQTQGPWALQRLFDAAELTPGSAPESFTATFHLGARRLVLKITADSAFNPFRLPQMAA
FSCPE
 
Nucleotide Sequence: 3588 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1913771-1917358 Frateuria aurantia DSM 6220 chromosome, complete genome
GTGATCATCAGCTGGTTGCGAAGTCTGTTCAGCTTCCTGTTCGCCCGTGAACTCTGGATTGCGCTGGCGG
TGCTGCTGCTGGCCGTCCTGATCTGGGGATACGGTCCCTTGCTGGCACTGGGAACCTGGCATCCACTGAC
GGCGGCGTGGGCGCGCGTAGGCGTGATCGGGCTGCTGATCATGGCCTTGTTGTGGCGCTGGTCATGGCGG
TTCGGTGGTGGTTCCGGTCGCCGTCTGCTGGAGCAGCTGCGGCGTCGCCGGGAGGCCGTACCGGCACCAC
CGCCGGAGGTCCAGGCCAGCGAGTTGCGCCAGCGATTCCAGCAGGCGCTGTGGACGCTGCGCGATGCCAG
AGCGGACAGCCGTCGCTGGACGCATTGGCTGGATCGGCTCAGCGGCCAGTATGTGTACCGCCTGCCGTGG
TATCTGGTGGTTGGTGACACCGGCAGCGGCAAGACGGCCTTGCTGCATCAGTTGCGCGGTGGCGCCCCCA
GCCTGGAGTTCGCCGGTGCGGCGGGGGGGGGAGCACATACCGCGCAACTGGAATGGCATCTGGGGGACAG
TGCGGTGCTGGTGGACACGCCGGGACGATTTATCGAAGCGGCGCCGGCCGCCGACAGCGACCGGGTCGAA
TTCCATCAGTTGCTGCGCCATTTCCGGCCGCGCCAGCCCCTCAACGGCGTGGTGCTGGTGATCGATGTCA
GCCAGCTGCCGGGCATGGCGAGCGACGTGCGCAAAGCCCATGGAAGACGGTTGCGCACGCATCTGCTGGA
GCTGCAACAGGGCCTGGATATCCGGCTGCCGGTTTATCTGGTGCTCACTCATGTCGACCGGCTGACCGGC
TTCCAGGCTTATTTCCACGAGCTGGGGCCGCAAGGCCGGGAACAGGTCTGGGGCTTTACCGGCAATGCCT
CCGAGACTCCAGCCAGGCAGGGGCTGGAAACCATCTTCCTTCGCGAGTTCAAGGCGCTGGTCGATCGTCT
CGGTGATGGTCTGATCGACGTGCTGGCCAGCGAGCCCGAACTGGGGGACCGGGCAGAGGCCTGGCTGTTT
CCGCAGGAATTTGCCCAACTGGAGCAGCCCTTGCTGGAATGGCTGACGGCCTTGAGCCGGGCATCGCGGT
TCGAACCCGAGCTATGGCTGCGCGGAGTGTATTTCACCAGTAACGGACGGGGCGGAGCGGTCATCGAGCA
GGTGCTGGCTCCGATCAGGCAGACCTTGCAATTGGAGCCGCACGCCGCCGAAGCCGTTCCGGAGGGGAGG
CAGAGTTATTTCAGCGCACGGCTGCTGGACCACCTGATGGTGCCGGAGGCCGGTCTGGCCGGCATCAACC
GCCGCCTGCTGTGGCGCCGGCGCCTGCTGCATGGAGCCAGCCTGGGACTGTTGGCCACGGTGGTCCTGGT
ATGCCTGGCGGTGTGGATCAACAGCTACCGGCACAATCGGGATTATCTGGCCGAAGTGGGCCGCCATGCA
GCCGAATACCAGGCTCGGGCCGGCAGCCACATCAGTTTGCCCGCAGGCGATATCGAAGCACTGGCCCCGC
TGCTGGATCCTCTTCTGCAATTGCCGCTGAGCCGGCAGTTCGATACCACCCATCCACCTTTCTACAGCTA
TCGGGCCGGCCTGTATCAGGGCCACAAGATCCAGATCGCGACCAATCTGGTCTATCGGCGGGCTCTTGAG
GAAAAGCTGCTGCCCCAGGCCGCCAGTCGCATTCAGAATCTGCTTGCCAGTGCCCCTGCGGATGACCTGG
AATACACCTACAACGCATTGAAAGCCTATTTGATGCTGTATCAATCCGGCCATTACCAGGCGGATTTTCT
TTCCGCCTGGCTGCTGCTCGATGTCGAGAAGTCGATGCCGGAGGTCACCACCCGGCATCAGCGGGAGGCT
CTGGAGAACCATGTGGCGGAGTTGTTCCAGCCGCATCCGGTGACCTCGCCGTTTCCCTTCGACGCGGATC
TGGTACGCAGCGCCCGTGAGCGTCTGGCGCGTTATTCGTTGCCCCAACGGGCCTACCATCAGATGCAGCG
ACGGCTGCTGGGATCGATGCGTGGAGACCCGGTCAGCGTGGAGAGCGTGGCGGGGCCGCAGGCATCAATG
GCACTGGTGCGCAAGAGTGGTCAGCCGCTGAGTGACGGCATCGCGCCCCTGTATACCTATCAGGGCTATT
GGGACGTGTTCTCGCCACAGGTCGGACATGCGGCTCTGGACATGGAGAAGGAGGATGTATGGGTGTTGGG
CAGCCGTCAGGCACCCATACTGGATGATCTGGATCGGAGTCGATTGACTCGCGAAATCAAGCGGCTTTAT
TTCAACGACTATATCCGGGTCTGGGATGCCTACCTGGGCGATCTGACCGTGATCGAGACCCGCTCGGTCA
ATCAGAGCATGCAGCTGGCCCGCATCCTGTCGGCGACCGACTCCCCACTGAAGCGCTTCATGCTGGTCGC
CGCCCGTGAAACCACCTTGCTGCATGATCGCCAGAGCCAGCCCAGCCATTCACTGCTGGGTAGGGCACAG
GCCCGTATCGGCGAGGTCAAGCAGTCATTGACGGACATTTTCGGCAATCAGGTCATACCGGCCAATCGCG
CTGAGACGGAAGATCGCATCGAGAGCATGGTCGACAACCACTTCGAGCCCCTGCACAGGATGGTCGACGG
CAGTGGCAGCGATGGCCAGGGACCGTCACCGCTGGATACCAGTCTGCAGGTGGTGGACGAACTCTACAAC
TATCTCACTGCCACCGATGCCGCACTGGGCAGCGGCAATCCACCTCCGCCTTCGGATGTCTTCAACAAAC
TGCAGGCCGAAGCCGGACGCATGCCGATGCCGTTCCGGCAGATCATGGGTGATCTGGCGGTCCGCGGTTC
CGCGCAGGTGACCGGCGCGGTCCAGCACAGCATCGACGAGGATGCGGCCGCATCGATCGGACGACTGTGC
CGGCAGACGATCGCCGATCGCTATCCGTTTGTACGCGGCATTTCCCGGGATGTGGCCATCGACGATTTTT
CCAGGATGTTCGCACCGAACGGGTTGATGGATGCCTTCTACCAGAAGAATCTGGCCGCGCGGGTCGACAT
GAACACGCGCCGTTGGACCTTTCGACCCAGTGCCGGCGGTGTGCGGCATGGCAATCCGCATCTGCTGGAG
GCGTTTCAGAATGCAGAGACCATCCGCAACGTGTTCTTCGCCGCCGGCGGCAACCGTCCCAGTCTGAAAT
TCGATGTCATGCCTCTGGATCTGGATGCCTCCATCAACCAGTTCACTCTGGATGTCGATGGTCAGGTCCT
GCGCTATGCGCATGGTCCGCAGATTTCCAGGACCATGAGCTGGCCGGTGCAGGCTGGCAGCCATCAGGTG
AGGCTGGAGCTGACGCCGGCAAGTGCGTCGGGGAGCCTGCAGACCCAAGGGCCCTGGGCCTTGCAGCGGC
TGTTCGATGCAGCCGAGCTGACACCCGGCAGCGCGCCCGAGAGTTTTACCGCCACCTTCCATCTGGGGGC
ACGTCGGCTGGTGCTGAAAATCACAGCCGACAGTGCCTTCAATCCGTTCCGGTTGCCGCAGATGGCCGCG
TTCAGCTGTCCGGAATAA
 Primer design