SecReT6
Protein ID: 383456134
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04151
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5168548..5172369 [+]
Producthypothetical protein
NoteTssM
UniProt IDH8MXE4
KEGG IDccx:COCOR_04151
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 7.40E-15, Aligned region: 807..827
DUF1215 [PF06744], Evalue: 7.40E-15, Aligned region: 1014..1126
Protein Sequence: 1273 a.a.     [Download]
>gi|383456134|ref|YP_005370123.1| hypothetical protein COCOR_04151 [Corallococcus coralloides DSM 2259]
MGALQSMLAALKAHWVLVLGIVVVLAAIGVGVTLWWRKRQQRGPALGSEQKPLGSGQLLAIRKQFLAKLP
WRFRASVRDFPTLVVLGPAGSGKSDLIEAEVDWERQQRQFMPSYTDDPLLKVFLGPEVVVQELAAPVLED
DSLHARRALRRLWKATFGRRHVGRAVIVLKVNWLLETSPDEVKRVTQLLRGKVNLLSEVCQSPVETRLVL
THMDTLDGYADFAQLLRKNGVPLELTVPPPGREGELGEALQPMEKYLALGLTSLSPDAFERLASFYSRGG
EAFAALGRFVSTLLEGGSLAYPLKLQRVFLSSGGADAQPTGALAVQADQPAEVLVRDYRWTHLRRCAVIL
AVGCLPVLLAYAHFYRLLLRAQDKLDAFQVTVQRLEERNQSVSGSVVESQTGDAVKAMEDLWSATRYWPP
LEHSFTDEWAELRARLARSIRMSYLKPMLEKCQDQCRRCPGQIPGCQPAPAFANRGTRATPLVPAPSADD
SCHMETLCRPEQVLYTLGVLYASRNEDLGQFVLRSVHGTHKKQLGWTAEAFGLSLASTDQEHNWLEAMGL
AEPMIANYVIASDKPFDENVPWTRWPFAWLTMDGLLGPWRDHFMQLQETLSAKELDLARWRALADDRERL
RASLAESAPYSSARKVMDLINASDAEPDASQLKGVGSLLDSLDWLRQNRQTLEAILRMEDETDAALRAAA
RMTPAELLTRADGLFAPSDGDARYQVEVLRRDFEFRPMDVSRQLLDKVLRSLKETGRTPFNADSFNPRAG
ETTSEVATEGAGDDDTEFTSGTAPVVGKVLGKAAFEAQLSPLVDEFTERLAKSSLSREEAVERATFVQGK
VQTFAKRYGQDLYATYRGYRFRTTPRGSLASDLSVLLQPSSPLEAMLRDVAVRASVGPLESEYYAPMRDA
VAPFKPVVQLMTPDKSGVLVELAAYTTLVSQLQQELSGAKPAAAKPAAPNAAPGAAGATVSSAGSQLAEM
LTPVGRVALSMLLEEEDSYLRRVDAWLDQHGLVGEFRQPFRQPFIIVRNRGRAELERLIAEQWTYQARRT
LDPLVKRYPFNPSASQEVDPVELEVLRRKDGAFWGFVTQVLAPVVEERGTDWTLRYPLKSRLLLPPRMLS
ALGQLGRLSKLLWDDEGKPRPIPMQVRPLPLPSAPTPDSFVTLSYLKCGGAASFGFNQRPAWGEFPLSWW
SPQPSSIGVELRSPQRDGKRYRSMEMSESSWNCFRLLESATLTDQSNVVWVLPGRGLAANEKVLEISFGL
RGEPWAPFRGVVP
 
Nucleotide Sequence: 3822 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5168548-5172369 Corallococcus coralloides DSM 2259 chromosome, complete genome
GTGGGCGCGCTCCAGTCCATGCTGGCGGCCTTGAAGGCCCACTGGGTGCTCGTGCTGGGCATCGTGGTGG
TGCTCGCGGCCATTGGCGTGGGCGTGACGCTGTGGTGGCGCAAGCGGCAGCAGCGCGGCCCGGCGCTCGG
GAGCGAGCAGAAGCCGCTCGGGTCGGGACAGCTGCTGGCCATCCGCAAGCAGTTCCTGGCGAAGCTGCCG
TGGCGCTTCCGCGCGTCCGTGCGGGACTTCCCCACGCTGGTGGTGCTGGGTCCGGCGGGCAGCGGCAAGT
CGGACCTCATCGAAGCGGAGGTGGACTGGGAGCGGCAGCAGCGCCAGTTCATGCCCAGCTACACGGACGA
CCCGCTCCTCAAGGTGTTCCTGGGGCCGGAGGTCGTGGTGCAGGAGCTGGCCGCGCCCGTGCTGGAGGAC
GACTCGCTCCATGCGCGGCGCGCGCTGCGCAGGTTGTGGAAGGCCACCTTCGGGCGCCGGCACGTGGGCC
GGGCCGTCATCGTCCTGAAGGTCAACTGGCTGCTGGAGACGTCTCCGGACGAGGTGAAGCGCGTCACCCA
GCTCTTGCGCGGCAAGGTCAACCTCCTGTCGGAGGTGTGCCAGTCGCCCGTGGAGACGCGGCTGGTCCTC
ACGCACATGGACACGCTGGACGGCTACGCGGATTTCGCGCAGCTGCTCCGGAAGAACGGCGTGCCGCTGG
AGCTGACGGTTCCGCCGCCCGGCAGGGAAGGGGAGCTGGGCGAAGCGCTCCAGCCCATGGAGAAGTACCT
GGCGCTGGGCCTCACCTCGCTGTCGCCGGACGCGTTCGAGCGGCTGGCGTCGTTCTACTCTCGCGGCGGA
GAGGCCTTCGCGGCGCTGGGTCGCTTCGTGTCCACGCTGCTGGAGGGCGGCTCGCTGGCGTACCCGCTGA
AGCTCCAGCGCGTGTTCCTGTCCTCGGGCGGAGCGGATGCCCAGCCCACGGGCGCGCTGGCGGTGCAGGC
GGATCAACCGGCGGAGGTGCTCGTCCGGGACTACCGCTGGACGCACCTGCGCCGGTGCGCGGTCATCCTC
GCGGTGGGGTGCCTGCCGGTGCTGCTGGCGTACGCGCACTTCTACCGGCTGCTCCTGCGCGCGCAGGACA
AGCTGGACGCGTTCCAGGTCACGGTGCAGCGGCTGGAGGAGCGCAACCAGAGCGTGTCCGGCTCCGTGGT
GGAGTCCCAGACGGGCGACGCGGTGAAGGCGATGGAGGACCTCTGGAGCGCCACGCGCTACTGGCCGCCC
CTGGAGCACAGCTTCACCGACGAGTGGGCGGAGCTGCGGGCGCGGCTCGCGCGCAGCATCCGGATGTCCT
ACTTGAAGCCGATGCTGGAGAAGTGCCAGGACCAGTGCCGGCGCTGCCCGGGCCAGATTCCCGGCTGCCA
GCCCGCGCCCGCCTTCGCCAACCGGGGCACGCGAGCCACGCCGCTCGTCCCGGCGCCCTCGGCGGATGAC
AGCTGCCACATGGAGACGCTGTGCCGTCCGGAGCAGGTCCTCTACACGCTGGGCGTACTCTACGCCTCGC
GCAACGAGGACCTGGGCCAGTTCGTGCTGCGCAGCGTGCACGGGACGCACAAGAAGCAGCTCGGGTGGAC
GGCGGAGGCCTTCGGCTTGAGCCTGGCCAGCACCGACCAGGAGCACAACTGGCTGGAGGCGATGGGCCTG
GCGGAGCCGATGATCGCCAACTACGTCATCGCCAGCGACAAGCCCTTCGACGAGAACGTCCCCTGGACGC
GCTGGCCCTTCGCCTGGCTGACCATGGACGGCCTGCTGGGCCCGTGGCGCGACCACTTCATGCAGCTGCA
GGAGACGCTGTCCGCGAAGGAGCTGGACCTGGCCCGGTGGCGCGCGCTGGCGGACGACCGTGAGCGCCTG
CGCGCCTCGCTGGCTGAGAGCGCGCCGTACAGCTCCGCCCGCAAGGTGATGGACCTCATCAACGCGTCGG
ACGCCGAGCCGGACGCCAGCCAGCTGAAGGGCGTGGGCAGCCTGTTGGACTCGCTGGACTGGCTGCGCCA
GAACCGCCAGACGCTGGAGGCCATCCTGCGCATGGAGGACGAAACGGACGCCGCCCTGCGCGCCGCCGCC
CGCATGACGCCCGCGGAGCTGCTCACCCGCGCGGACGGCCTCTTCGCCCCCAGCGACGGGGATGCGCGCT
ACCAGGTGGAGGTCCTCCGGCGCGACTTCGAGTTCCGCCCCATGGACGTGTCGCGGCAGCTGCTGGACAA
GGTGCTGCGCTCGCTGAAGGAGACGGGCCGCACGCCGTTCAACGCGGATTCGTTCAACCCGCGCGCGGGC
GAGACGACGTCGGAAGTGGCGACCGAAGGGGCGGGGGACGACGACACGGAGTTCACCAGCGGGACGGCTC
CGGTGGTGGGCAAGGTGCTGGGCAAGGCCGCCTTCGAGGCGCAGCTGAGCCCGCTGGTGGACGAGTTCAC
GGAGCGGCTCGCCAAGTCCAGCCTGTCTCGCGAGGAGGCCGTGGAGCGCGCCACCTTCGTGCAGGGCAAG
GTGCAGACCTTCGCGAAGCGCTACGGCCAGGACCTCTACGCGACGTACCGGGGCTACCGCTTCCGCACCA
CGCCGCGAGGCTCGCTGGCCAGCGACCTGTCCGTGCTGCTGCAGCCGTCGTCGCCGCTGGAGGCAATGCT
GCGCGACGTGGCGGTCCGCGCCAGCGTGGGCCCGCTGGAGAGCGAGTACTACGCGCCCATGCGCGACGCG
GTGGCGCCCTTCAAGCCGGTGGTGCAGCTGATGACGCCGGACAAGAGCGGCGTGCTCGTGGAGCTGGCGG
CCTACACCACGCTGGTGTCGCAGCTTCAGCAGGAGCTGTCCGGCGCGAAGCCCGCGGCCGCGAAGCCCGC
CGCTCCCAACGCGGCGCCCGGGGCCGCTGGCGCGACGGTGTCCTCGGCGGGCTCGCAGCTGGCGGAGATG
CTGACGCCGGTGGGGCGCGTGGCGCTGAGCATGCTGCTGGAGGAGGAGGACTCGTACCTGCGCCGGGTGG
ACGCGTGGCTGGATCAGCACGGCCTGGTGGGCGAGTTCCGGCAGCCGTTCCGCCAGCCCTTCATCATCGT
GCGCAACCGGGGCCGCGCGGAGCTGGAGCGCCTCATCGCGGAGCAGTGGACGTACCAGGCCCGCCGCACG
CTGGACCCGCTGGTGAAGCGCTATCCGTTCAATCCCAGCGCGTCGCAGGAAGTGGATCCGGTGGAGCTGG
AGGTGCTGCGCCGCAAGGACGGGGCCTTCTGGGGCTTCGTCACGCAGGTGCTGGCGCCGGTGGTGGAGGA
GCGCGGGACGGACTGGACGCTGCGCTATCCGCTGAAGTCCCGGCTGCTGCTGCCGCCGCGCATGCTCTCC
GCGCTGGGCCAGCTGGGCCGCCTGTCGAAGCTGTTGTGGGATGACGAGGGCAAGCCCCGGCCCATCCCCA
TGCAGGTGCGTCCGCTGCCGCTGCCGTCGGCGCCCACGCCGGACAGCTTCGTGACGCTGTCGTACCTGAA
GTGCGGCGGGGCGGCGTCGTTCGGCTTCAACCAGCGGCCCGCGTGGGGTGAGTTCCCGCTGAGCTGGTGG
AGCCCGCAGCCGTCGTCCATCGGCGTGGAGCTGCGCTCGCCGCAGCGGGATGGGAAGCGCTACCGCTCCA
TGGAGATGTCCGAGTCGTCATGGAACTGCTTCCGCCTGCTGGAGTCCGCGACGCTGACGGATCAGTCCAA
CGTGGTGTGGGTGCTGCCGGGACGCGGACTGGCGGCGAACGAGAAGGTTCTGGAGATCAGCTTCGGGTTG
CGCGGCGAGCCTTGGGCGCCATTCCGTGGGGTGGTGCCATGA
 Primer design