SecReT6
Protein ID: 383758442
SecReT6 ID565
T6SS typei4b
Gene symbolicmF
Locus tagRGE_25890
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2726443..2730252 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDI0HSE1
KEGG IDrge:RGE_25890
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.90E-74, Aligned region: 182..443
ImcF-related_N [PF14331], Evalue: 8.90E-74, Aligned region: 498..510
IcmF-related [PF06761], Evalue: 8.40E-54, Aligned region: 487..833
DUF1215 [PF06744], Evalue: 5.90E-27, Aligned region: 771..793
DUF1215 [PF06744], Evalue: 5.90E-27, Aligned region: 966..1081
Protein Sequence: 1269 a.a.     [Download]
>gi|383758442|ref|YP_005437427.1| type VI secretion protein IcmF [Rubrivivax gelatinosus IL144]
MNRIWTFLLNPRVLGVIGLAALAAFLFLGANTLQLALVWAGIALGVLLAVGLSVWGVRKLRARRAARALE
QAIEVPGEAEKQVPRADVSALRARLVDAVKTIQKSKLGQLSGSAALYELPWYMVIGNPAAGKSTAIVKSG
LKFPFADGGDAVVQGIGGTRNCDWFFTSEGILLDTAGRYAVHEEDRQEWLGFLGLLKRHRPKAPINGILI
AASLAELGSGRPEAAIQLAKNLRQRVQELTETLEVIAPVYLVFTKADLIAGFAEFFEDRDRSERERVWGA
TLPYAQAQRGDAVAAFDRHFDELYDGLKQMTLARMAMERGKALPPGVLTFPLEFAERKTALRAFVATLFE
ENPYQYQPVFRGFYFTSSVQEGSSASKASERVAQQFALEPRADRLSGLVVAENGFFLKDLFSKVIFADKG
LVQQHASRTKQRLRLATFSAALLLLALATGGWTWSYVGNRQLMANVRADLDHAVRLQAENPDLGSRMQAL
ETLQDRIEQLQRYRQDRPLGISLGLYQGEEIEAKLRQEYFAGIRQVMLEPAAAAIEAYLAEVSANPGRLK
PLGKPPESAAATAAAPSTAGRYVDASVEDAGDAYNALKTYLMLADRERIEPVHLAEQITRFWRGWLDSNR
GSMPRERLMQSAERMISFTAGLSRDPAFPTVANKLALVDQMRELLREQRRGVKGVERVYADIKTRASTRY
PPMTVARLIADGDKDVIAGSHAIPGTFTREAWEGYIAKAFKDAATQELQSTDWVLNIAARDDLTLEGSPE
QIQKQLTELYKTEYVREWQRFMQGISIAEFGSFDEAVKRMNRLGDPADSPIRILLTTLFDQTSWDNPSLL
NERLGKAQKGFVDWIRQTILRQAPQRVEVKVDVTGANAGVPMGPIGREFAALSRIMMSRDSTPPPIKAYL
ESLSKVRTRFNQIKNQGDPGPGSRALLAATLEGPGSELAEALKLVDEQLLLGMTDSAKATLRPLLVRPLI
QALAVVVPPAETELNRFWAAQVSEPFQRTLASKYPFDTRSTVEAAPQDIAKIFGPDGAIAKFSNEALGPL
VVRRGDAIEPRQWAEIGVRLRPEFTTGFGNWVAQLDAASGGGGAVTTAGSSGAVTVAADQTLFQILPQGA
PGFVEYTVTIDGQSLRYRNAAAQWTDMVWPNRAGVAGARLSGVTHDGKTVEFVNEPGSAGLGKFMELAQK
KRLDGGVNELKWTQGPYSVTVHLRVLRQPGESPPTSSRAGAAPGAAPIGTSRLQGLKLPALVAGVEASAA
AASSPKASP
 
Nucleotide Sequence: 3810 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2730252-2726443 Rubrivivax gelatinosus IL144, complete genome
ATGAACCGAATCTGGACCTTCCTGCTCAATCCGCGAGTGCTCGGCGTGATCGGTCTTGCGGCGCTGGCAG
CATTCCTGTTCCTCGGCGCCAACACGTTGCAGCTCGCGCTGGTCTGGGCCGGCATCGCGCTCGGCGTGCT
CCTTGCCGTCGGGCTCTCGGTGTGGGGCGTCCGCAAGCTGCGCGCTCGACGGGCCGCACGAGCGCTGGAA
CAGGCAATCGAAGTTCCGGGCGAGGCCGAGAAACAGGTTCCGCGCGCCGACGTGTCTGCGCTGCGCGCGC
GCCTGGTGGACGCGGTCAAGACCATCCAAAAGAGCAAACTCGGCCAGCTCTCCGGCAGCGCCGCGTTGTA
CGAGCTGCCCTGGTACATGGTGATCGGCAACCCGGCCGCAGGCAAGAGCACGGCCATCGTCAAGAGCGGG
CTCAAGTTCCCGTTCGCCGATGGCGGCGATGCGGTAGTCCAGGGCATCGGCGGCACGCGCAACTGCGACT
GGTTCTTCACCAGCGAAGGCATCCTGCTCGACACCGCCGGCCGCTACGCCGTGCACGAGGAGGACCGCCA
GGAGTGGCTGGGTTTTCTGGGGCTGCTCAAGCGCCACCGGCCGAAGGCACCGATCAACGGCATCCTCATC
GCTGCGAGCCTGGCCGAACTAGGCAGCGGACGGCCCGAGGCCGCCATCCAGCTGGCGAAGAACCTGCGCC
AGCGCGTGCAGGAGCTCACCGAGACGCTGGAAGTCATCGCGCCGGTGTATCTGGTCTTCACCAAGGCCGA
CCTGATCGCCGGCTTTGCCGAGTTCTTCGAAGACCGCGACCGCAGCGAGCGCGAGCGCGTGTGGGGCGCC
ACCCTGCCCTATGCCCAGGCGCAGCGCGGTGACGCGGTGGCCGCGTTCGACCGCCACTTCGACGAACTCT
ACGATGGCCTGAAGCAGATGACGCTGGCGCGCATGGCGATGGAGCGCGGGAAGGCGCTGCCCCCCGGCGT
GCTGACCTTCCCGCTGGAGTTCGCCGAGCGCAAGACGGCGCTGCGCGCCTTCGTGGCCACACTGTTCGAA
GAGAACCCGTACCAGTACCAGCCGGTGTTCCGGGGCTTCTACTTCACGAGCAGCGTGCAGGAGGGAAGCT
CGGCGAGCAAGGCTAGCGAGCGGGTGGCACAGCAGTTCGCGCTCGAGCCGCGTGCCGATCGCCTCTCGGG
CCTCGTCGTCGCCGAGAACGGGTTCTTCCTGAAGGACCTGTTCAGCAAGGTCATCTTCGCCGACAAGGGC
TTGGTGCAGCAGCACGCCAGCCGCACAAAGCAGCGGCTGCGGCTGGCGACCTTCTCGGCGGCGCTGCTGC
TGCTGGCGCTGGCAACCGGCGGCTGGACATGGTCGTACGTGGGCAACCGGCAGCTGATGGCCAATGTGCG
CGCCGATCTCGACCATGCCGTACGCCTGCAGGCCGAGAACCCCGACCTCGGATCGCGCATGCAGGCGCTG
GAGACACTGCAAGACCGCATAGAGCAACTGCAGCGCTACCGCCAAGACAGGCCGCTGGGCATCAGCCTCG
GCCTGTACCAGGGCGAGGAGATCGAGGCCAAGCTGCGCCAAGAGTACTTCGCCGGCATCCGGCAGGTGAT
GCTGGAGCCGGCGGCGGCGGCGATCGAGGCCTATCTCGCGGAGGTCAGCGCAAACCCCGGCCGCCTGAAG
CCGCTGGGCAAGCCACCCGAGTCCGCCGCGGCGACGGCAGCCGCGCCGAGCACCGCCGGCCGCTACGTCG
ATGCATCGGTCGAGGATGCGGGCGATGCCTACAACGCGCTCAAGACTTACTTGATGCTCGCCGACCGCGA
ACGCATCGAGCCGGTGCATCTGGCCGAGCAGATCACCCGGTTCTGGCGCGGCTGGCTCGACAGCAACCGC
GGCAGCATGCCGCGCGAGCGCCTGATGCAGAGCGCCGAGCGCATGATCAGCTTCACTGCCGGGCTCAGCC
GCGACCCCGCCTTCCCGACCGTCGCCAACAAGCTCGCTCTGGTCGACCAGATGCGCGAGCTGCTGCGCGA
ACAGCGTCGCGGGGTGAAGGGGGTTGAGCGCGTGTACGCGGACATCAAGACCCGCGCGTCCACCCGCTAC
CCGCCGATGACCGTCGCGCGGCTGATCGCCGATGGCGACAAGGACGTCATCGCTGGCAGCCATGCAATCC
CCGGCACCTTCACCCGCGAGGCCTGGGAGGGGTACATCGCCAAGGCCTTCAAGGATGCGGCCACGCAGGA
GTTGCAGAGCACCGACTGGGTGCTGAACATCGCCGCCCGCGACGACCTCACGCTCGAAGGCAGCCCGGAG
CAGATCCAGAAGCAGCTGACCGAGCTGTACAAGACCGAGTACGTGCGCGAGTGGCAGCGCTTCATGCAGG
GCATCTCGATCGCCGAGTTCGGCAGCTTCGACGAGGCGGTCAAGCGCATGAACCGGCTGGGCGACCCGGC
GGACTCGCCGATCCGTATCCTGCTGACGACGCTGTTCGACCAGACATCCTGGGACAACCCGTCGCTGCTG
AACGAGCGCCTGGGCAAGGCGCAGAAGGGCTTCGTCGACTGGATCCGCCAGACCATCCTGCGGCAGGCGC
CGCAGCGCGTGGAAGTGAAGGTCGACGTGACCGGCGCCAATGCCGGCGTACCGATGGGGCCCATCGGGCG
CGAGTTCGCGGCGCTGTCGCGCATCATGATGTCGCGCGACAGCACGCCGCCGCCGATCAAGGCGTACCTG
GAGAGCCTGTCGAAGGTCCGCACGCGCTTCAACCAGATCAAGAACCAGGGCGATCCCGGCCCCGGCTCGC
GCGCGCTGCTGGCCGCCACGCTCGAAGGCCCCGGCTCCGAGCTGGCCGAGGCGCTGAAGCTGGTCGACGA
GCAGTTGCTGCTGGGCATGACCGACAGCGCTAAGGCCACGCTGCGGCCGCTGCTGGTGCGCCCGCTGATC
CAGGCGCTGGCGGTGGTGGTGCCACCGGCCGAGACCGAGCTCAACCGCTTCTGGGCCGCACAGGTCTCCG
AACCCTTCCAGCGCACGCTCGCATCGAAGTACCCGTTCGACACCCGCTCGACCGTGGAGGCTGCGCCGCA
GGACATCGCCAAGATCTTCGGCCCTGACGGCGCGATCGCGAAGTTCTCCAACGAGGCGCTAGGGCCGTTG
GTGGTACGCCGCGGCGACGCCATCGAGCCGCGCCAGTGGGCCGAGATCGGCGTGCGGCTGCGTCCGGAGT
TCACCACCGGCTTCGGCAACTGGGTCGCGCAACTCGACGCCGCCAGCGGCGGCGGCGGCGCAGTCACCAC
GGCCGGCAGCAGCGGGGCGGTGACGGTGGCGGCGGACCAGACGCTGTTCCAGATCCTGCCGCAGGGTGCG
CCCGGCTTCGTCGAGTACACGGTGACCATCGACGGCCAGTCGCTGCGCTACCGCAATGCCGCCGCGCAGT
GGACCGACATGGTCTGGCCCAACCGTGCCGGCGTGGCAGGCGCGCGGCTCAGCGGCGTCACCCACGATGG
CAAGACCGTCGAGTTCGTCAACGAGCCTGGCAGTGCCGGGCTCGGGAAGTTCATGGAGCTGGCGCAGAAG
AAGAGGCTGGACGGCGGCGTCAACGAACTGAAGTGGACGCAGGGGCCTTACTCCGTCACGGTGCATTTGC
GGGTGCTGCGCCAGCCCGGGGAATCGCCACCGACCAGCAGCCGTGCCGGCGCCGCGCCAGGCGCGGCGCC
GATCGGCACCAGCCGGCTGCAAGGGCTCAAACTGCCGGCGCTGGTGGCAGGGGTCGAAGCGAGCGCAGCG
GCGGCGTCCTCGCCGAAGGCATCGCCATGA
 Primer design