SecReT6
Protein ID: 383785505
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2273
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2335440..2335940 [+]
Producthypothetical protein
NoteTssB
UniProt IDI0IRP6
KEGG IDlfc:LFE_2273
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-53, Aligned region: 5..162
Protein Sequence: 166 a.a.     [Download]
>gi|383785505|ref|YP_005470075.1| hypothetical protein LFE_2273 [Leptospirillum ferrooxidans C2-3]
MDDQGSVAPKERVNIVYRPATGDAKEEVELAFKQLVVGDFTQKEDDRQLEEIKPINVDKDNFDNVLESHK
LSLDLTVPNSLETRKPGEEPENMSVSLKFKSLKDFDPDSIVEQVPELRELIALRDALKALKGPLGNIPDF
RKKLQEIIQNEGTREKFLSELGIKNS
 
Nucleotide Sequence: 501 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2335440-2335940 Leptospirillum ferrooxidans C2-3, complete genome
ATGGATGATCAAGGTTCTGTCGCCCCCAAGGAAAGAGTCAATATCGTCTACCGTCCGGCGACGGGAGATG
CGAAGGAAGAAGTCGAACTGGCCTTCAAGCAGCTCGTGGTCGGAGACTTCACCCAGAAAGAAGACGACCG
GCAGCTTGAAGAGATCAAGCCCATCAATGTGGACAAGGACAACTTCGACAATGTCCTTGAAAGCCACAAG
CTCTCTCTTGACCTGACCGTCCCCAACAGCCTGGAAACCAGGAAGCCCGGAGAAGAGCCCGAAAACATGA
GCGTCTCCCTGAAGTTCAAGAGCCTCAAGGATTTCGACCCCGACTCCATCGTCGAGCAGGTTCCCGAACT
TCGAGAGCTGATCGCACTGAGAGATGCCCTGAAAGCCCTGAAGGGACCACTGGGGAATATTCCCGATTTC
CGGAAGAAACTTCAGGAGATCATCCAGAACGAAGGAACCCGGGAAAAATTCCTCTCCGAACTTGGCATCA
AGAATTCCTGA
 Primer design