SecReT6
Protein ID: 383785506
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2274
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2335978..2337471 [+]
Producthypothetical protein
NoteTssC
UniProt IDI0IRP7
KEGG IDlfc:LFE_2274
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-184, Aligned region: 70..495
Protein Sequence: 497 a.a.     [Download]
>gi|383785506|ref|YP_005470076.1| hypothetical protein LFE_2274 [Leptospirillum ferrooxidans C2-3]
MAENAQDQKGQSQSSEQPTFSDSLIDDLVEATRLKPGDEAYSITRQGVKAFINELLEPQRAVEKVTQATV
DEMIAELDKKLCHQVDAILHNAEFQKMESAWRSLKFLVDRTDFRENNKIEILNVSKQKLLEDFEDAPEIT
KSGLYKIAYTNEFGQFGGQPYGTIIANYEMNPGPQDIKLLQNIASVATMAHAPFIAAAGPEFFGVDDFSK
LPNLKDLASIYEMPQFTKWNSFRESDDSRFVGLTVPRFMLRLPYGQGTVPSKKFNYQEDVSGGNSSFLWG
NASFAFASRLSESFAKYRWNTNIIGPQGGGAVTNLPIYNFEAMGEVQSKIPTEILVSERREFELAEQGFI
GLTMRKNSDNAAFFSANSTQKAKIFAQTKEGKEAELNYKLGTQLPYIFVVSRLAHYIKIIQRENIGTWKE
RGDLETELNNWIRQYVSDMDNPAPGVRSRRPLRQAEIVVSDVDGDPGWYRVSLKVRPHFKYMGASFTLSL
VGKLDKK
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2335978-2337471 Leptospirillum ferrooxidans C2-3, complete genome
ATGGCAGAAAACGCCCAGGATCAAAAAGGGCAGTCCCAGTCGTCAGAACAACCCACCTTCAGCGATTCCC
TGATTGACGATCTCGTGGAGGCGACACGGCTCAAACCGGGAGACGAGGCCTACTCCATCACCCGACAGGG
AGTGAAAGCCTTCATTAACGAACTCCTCGAACCGCAGAGAGCCGTCGAAAAAGTCACCCAGGCCACCGTC
GACGAAATGATCGCCGAACTCGACAAAAAACTCTGCCATCAGGTGGACGCCATCCTCCACAACGCGGAGT
TCCAGAAGATGGAATCGGCCTGGAGATCGCTCAAGTTCCTCGTCGACCGGACCGATTTTCGCGAAAACAA
CAAGATCGAGATCCTGAATGTCTCCAAACAGAAACTCCTCGAAGACTTCGAAGACGCCCCCGAAATCACC
AAATCCGGACTCTACAAGATCGCCTACACCAACGAATTCGGACAGTTTGGCGGACAGCCCTACGGAACCA
TCATCGCCAACTATGAAATGAACCCCGGCCCACAGGACATCAAGCTCCTCCAGAATATCGCGAGCGTCGC
CACCATGGCCCACGCGCCATTCATCGCCGCCGCCGGCCCGGAATTTTTCGGAGTGGACGATTTCTCGAAA
CTTCCGAACCTGAAGGATCTGGCCTCGATCTACGAAATGCCCCAGTTCACCAAATGGAACAGCTTCCGCG
AAAGCGACGACTCCCGCTTCGTGGGTCTGACCGTCCCCCGATTCATGCTTCGTCTTCCCTACGGGCAAGG
CACCGTTCCCTCCAAAAAATTCAACTACCAGGAAGATGTCTCGGGCGGCAACAGCTCGTTTCTCTGGGGA
AACGCCTCGTTCGCCTTCGCGTCGAGACTGTCGGAGAGCTTTGCCAAATACCGCTGGAACACAAACATCA
TCGGACCTCAAGGTGGTGGCGCCGTGACCAATCTCCCGATCTACAACTTCGAAGCGATGGGGGAGGTCCA
GAGCAAGATTCCCACAGAAATCCTCGTCTCGGAGCGGCGGGAATTCGAACTGGCCGAACAGGGCTTCATT
GGATTGACCATGCGAAAGAACAGCGACAACGCCGCTTTCTTCTCGGCAAACTCCACCCAGAAAGCCAAAA
TCTTCGCCCAGACAAAAGAAGGCAAGGAGGCCGAGCTCAACTACAAGCTCGGGACCCAGCTTCCCTATAT
TTTTGTCGTGAGCCGGCTCGCCCATTACATCAAGATCATCCAGCGGGAAAACATCGGAACATGGAAAGAG
CGGGGCGATCTCGAAACGGAGCTCAACAACTGGATCCGCCAGTACGTCTCCGACATGGACAACCCCGCGC
CCGGCGTCCGGAGCCGGCGCCCCCTCAGGCAGGCCGAAATTGTCGTGTCCGATGTTGACGGAGATCCGGG
ATGGTACCGGGTTTCCCTGAAGGTCAGGCCCCACTTCAAGTATATGGGCGCCTCCTTCACCCTGTCTCTT
GTCGGGAAGCTCGACAAGAAATAA
 Primer design