SecReT6
Protein ID: 383785507
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2275
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2337511..2337999 [+]
Producthypothetical protein
NoteTssD
UniProt IDI0IRP8
KEGG IDlfc:LFE_2275
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.50E-40, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|383785507|ref|YP_005470077.1| hypothetical protein LFE_2275 [Leptospirillum ferrooxidans C2-3]
MPMPCYLHLQGKQQGKIEGSCSIKGREGTIQVQAFDYAVELPKNPQTGLPTGRRVHNPIMITKEIDKSSP
KLFQALCTGEQMSKVTLDWYRINPQGKEEKYYTTELENATVVSMRTWMPNVLRTEDRQMGHMEDVSFAFE
KITVTWADGGISGEDSWNSPKS
 
Nucleotide Sequence: 489 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2337511-2337999 Leptospirillum ferrooxidans C2-3, complete genome
ATGCCGATGCCATGCTATCTCCATCTTCAGGGAAAACAACAGGGAAAAATTGAAGGATCCTGCTCCATCA
AGGGACGCGAAGGCACCATCCAGGTTCAGGCGTTCGACTACGCTGTGGAGTTGCCTAAAAACCCCCAGAC
GGGACTCCCCACCGGCCGAAGGGTCCATAACCCGATCATGATCACCAAGGAAATCGACAAAAGTTCCCCG
AAGCTCTTTCAGGCCCTTTGCACCGGAGAGCAGATGAGCAAGGTGACACTCGACTGGTACCGGATCAATC
CCCAGGGGAAAGAAGAAAAGTACTACACGACGGAGCTCGAAAACGCCACCGTCGTCTCCATGCGCACATG
GATGCCGAACGTCCTCAGAACCGAAGATCGCCAGATGGGCCATATGGAAGATGTCTCCTTCGCCTTCGAG
AAGATCACCGTCACCTGGGCGGACGGGGGCATCTCCGGTGAAGATTCCTGGAATTCACCAAAAAGCTAG
 Primer design