SecReT6
Protein ID: 383785508
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2276
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2338013..2338429 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDI0IRP9
KEGG IDlfc:LFE_2276
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.20E-17, Aligned region: 27..119
Protein Sequence: 138 a.a.     [Download]
>gi|383785508|ref|YP_005470078.1| GPW/gp25 family protein [Leptospirillum ferrooxidans C2-3]
MESRERILERIAFWKEGAERDRLSRYESVSSSVRAHLSRLLTTRKGSVPISPEYGVPDLSNIAGSFESGT
SLQMVQTILETVARFEPRLLSPKVRALDDTTELSSLRIEISGEILVNDQRTLIQIPAFVRANGEILLS
 
Nucleotide Sequence: 417 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2338013-2338429 Leptospirillum ferrooxidans C2-3, complete genome
ATGGAGTCCCGTGAACGCATTCTCGAGCGGATTGCCTTCTGGAAAGAAGGCGCGGAGAGAGACCGTCTTT
CAAGATACGAGTCGGTCTCCTCCTCCGTACGGGCCCATCTCTCCCGGCTTCTGACGACCCGGAAAGGATC
GGTTCCCATCTCCCCAGAATACGGTGTCCCGGATCTCTCGAATATCGCAGGATCCTTCGAATCGGGCACC
TCCCTCCAGATGGTCCAGACCATTCTGGAGACGGTGGCCCGTTTTGAACCCCGTCTTTTGAGCCCCAAGG
TCAGGGCCTTGGACGATACGACGGAACTGTCTTCCCTCCGGATCGAAATCTCGGGAGAGATCCTTGTAAA
CGACCAGAGAACCCTGATCCAGATCCCTGCCTTCGTCAGGGCAAACGGAGAAATTCTCCTGTCTTGA
 Primer design