SecReT6
Protein ID: 383785509
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2277
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2338520..2340253 [+]
Producthypothetical protein
NoteTssF
UniProt IDI0IRQ0
KEGG IDlfc:LFE_2277
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.10E-151, Aligned region: 3..577
Protein Sequence: 577 a.a.     [Download]
>gi|383785509|ref|YP_005470079.1| hypothetical protein LFE_2277 [Leptospirillum ferrooxidans C2-3]
MSNHFYEQELKRLRSLSKEFSAAHPSLAPMLAQESTDPDVERLLEGVAFLTGILHQRLNDQYPEFIQEVA
RVLFSQFLRPFPSSTILSFSPKGKIAESIVVPKGTRAASIPVDGTTCFFETCQELTVHPLTLTQTRADQE
EGKTASIHLTYTLTGMALSQFGASSLQFFLGGSYSEGSNHFYLLTRWLDRIELSSPGAPSTFLSPKSLKT
PAFDDSSALFPASPGSFSSYRLFQEFFVQPSKFLFLELSDLDQWTERGTGNSFTISFHLSKSPSRPLAPA
PRHFVLGAAPAINLYETDAEPIQVTHRQNDYPVTSSGVARGHFDIFGIKSVTGTETGSGKSFEYRPFQEI
LGQPKSPTTRAYRVVLRPSPVERRTETCLGLLYGSGEVPSHETLSLRILATNRFLPESLKPGEITRTTDN
SPERLTFTNLTAPTPYIHPPLGDDLSWRVLSQLGLNFLSLADASRLRSLLSLYLFPMERNKTLEDTNKKR
IESIREVTVKRITRLIRGILLRGSLIRIRVSGDGFADIADMSLFGSILNEFLAVYSTINSFTLVEIEDLL
TGELLTWPERLGTQTLI
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2338520-2340253 Leptospirillum ferrooxidans C2-3, complete genome
ATGTCGAATCACTTCTATGAACAGGAACTCAAGCGGCTCAGATCCCTGTCGAAGGAATTCTCGGCGGCCC
ACCCTTCGCTCGCCCCCATGCTCGCTCAGGAGTCGACCGATCCCGATGTGGAGAGACTCCTCGAAGGGGT
CGCTTTTCTCACCGGCATTCTCCACCAGCGGTTAAACGACCAGTACCCGGAGTTCATCCAGGAAGTGGCG
CGCGTCCTCTTTTCCCAGTTTCTACGGCCCTTTCCGTCATCAACGATCCTCTCCTTTTCCCCCAAGGGAA
AAATCGCGGAATCCATCGTTGTGCCGAAAGGAACTCGGGCGGCCTCCATCCCGGTAGACGGGACCACCTG
CTTTTTCGAAACCTGCCAGGAGCTGACCGTTCATCCCCTGACCCTGACCCAGACCAGGGCCGATCAGGAG
GAAGGGAAGACTGCCTCCATCCATTTGACCTATACCCTGACAGGGATGGCCCTATCGCAGTTTGGCGCCT
CCTCCCTCCAGTTCTTTCTGGGAGGAAGCTATTCGGAAGGATCCAACCATTTTTACCTTCTGACCCGCTG
GCTGGACCGGATCGAACTTTCTTCACCCGGAGCGCCTTCGACATTTCTGTCTCCGAAGTCTCTCAAAACC
CCGGCATTCGACGATTCTTCCGCTCTTTTTCCCGCCTCCCCGGGTTCATTTTCCTCCTACCGGCTCTTCC
AGGAGTTCTTCGTCCAGCCCTCGAAGTTCCTCTTTCTGGAACTTTCCGATCTGGACCAATGGACCGAAAG
AGGGACAGGAAACAGCTTTACCATCTCGTTCCACCTCTCAAAATCCCCCTCTCGCCCCCTTGCTCCCGCT
CCCCGCCATTTTGTCCTGGGGGCGGCGCCGGCGATCAACCTCTACGAAACAGATGCGGAGCCGATCCAGG
TCACACATCGTCAGAACGACTATCCGGTCACATCATCCGGAGTCGCCCGCGGACATTTCGACATCTTCGG
GATCAAGAGCGTGACGGGAACCGAAACCGGGAGCGGGAAATCATTTGAATACCGGCCCTTTCAGGAGATT
CTCGGACAACCCAAATCCCCCACCACCCGGGCCTACCGGGTGGTGCTCCGGCCATCACCGGTCGAACGCC
GGACGGAAACCTGCTTGGGGCTCCTGTATGGATCCGGGGAGGTCCCCTCTCACGAGACCCTCTCGCTCAG
GATCCTGGCCACGAACCGATTTCTCCCCGAGTCCCTCAAACCCGGAGAGATCACCCGGACCACCGACAAC
TCTCCCGAGCGGCTGACATTCACCAATCTCACCGCTCCCACTCCCTATATCCACCCACCTCTGGGGGACG
ATCTCTCCTGGAGAGTCCTCTCCCAGCTGGGGCTCAATTTTCTCTCCCTGGCCGATGCCAGCCGACTTCG
CTCCCTTCTCTCCCTCTATCTCTTTCCGATGGAGCGGAACAAGACCCTTGAAGACACCAACAAAAAACGC
ATCGAAAGCATCCGGGAGGTCACCGTCAAGAGGATCACCAGATTGATCCGGGGCATTCTGCTCCGGGGCT
CCCTGATCCGGATCAGGGTCAGCGGAGACGGATTCGCGGATATTGCCGACATGTCTCTCTTCGGATCGAT
CCTCAACGAATTTCTGGCGGTCTATTCAACGATCAACTCATTCACACTGGTCGAAATCGAAGATCTGCTC
ACAGGAGAACTGCTGACATGGCCCGAGCGGCTGGGCACACAGACACTGATCTGA
 Primer design